SecReT4
Protein ID: 169303020
T4SS name [ID]VirB [455]
Gene symboltaxB
Locus tagpOLA52_22
StrainEscherichia coli plasmid pOLA52 (NC_010378)
Repliconplasmid pOLA52 [GenBank: NC_010378] [Browse all T4SS(s) in this replicon]
Location [Strand]16153..17988 [-]
ProductTaxB protein
Component typeVirD4
UniProt IDB0ZDX6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 2.4e-143, Aligned region: 102..571
TraG-D_C [PF12696], Evalue: 3.5e-25, Aligned region: 416..534
TrwB_AAD_bind [PF10412], Evalue: 5.3e-19, Aligned region: 331..548
Protein Sequence: 611 a.a.     [Download]
>gi|169303020|ref|YP_001693193.1| TaxB protein [Escherichia coli]
MSLKLPDKGQWAFIGLVMCLVTYYTGSVAVYFLNGKTPLYIWKNFDSMLLWRIITESNIRTDIRLTAIPS
LLSGMVSSLIVPVFIIWQLNKTDVALYGDAKFASDNDLRKSKLLKWEKENDTDILVGAYKGKYLWYTAPD
FVSLGAGTRAGKGAAIGIPNLLVRKHSLIALDPKQELWKITSKVREILLGNKVYLLDPFNSKTHQFNPLF
YIDLKAESGAKDLLKLIEILFPSYGMTGAEAHFNNLAGQYWTGLAKLLHFFINYEPSWLNEFGLKPVFSI
GSVVDLYSNIDRELILSKREELEGTNGLDENALYHLRDALTKIREYHETEDEQRSSIDGSFRKKMSLFYL
PTVRKCTDGNDFDLRQLRREDITVYVGVNAEDISLAYDFLNLFFNFVVEVTLRENPDFDPTLKHDCLMFL
DEFPSIGYMPIIKKGSGYIAGFKLKLLTIYQNISQLNEIYGIEGAKTLMSAHPCRIIYAVSEEDDAAKIS
EKLGYITTTSKSTSKSRGRSTSQGESESEARRALVLPQELGTLDFKEEFIILKGESPVKAEKALYYLDPY
FMDRLMKVSPKLASLTMELNKTKKIFGVKGLKYPSKEKMLSVGELESEVLL
 
Nucleotide Sequence: 1836 bp     [Download]
>gi|169302998|ref|NC_010378.1|:c17988-16153 Escherichia coli plasmid pOLA52, complete sequence
ATGTCTTTAAAACTCCCAGATAAAGGCCAGTGGGCTTTTATCGGTCTGGTTATGTGTCTCGTGACATATT
ATACTGGTTCTGTTGCTGTTTACTTCCTGAACGGAAAAACGCCGCTTTATATATGGAAAAATTTTGATTC
CATGCTCCTATGGCGAATAATAACAGAGAGTAATATACGGACAGATATCAGGTTAACCGCTATCCCCTCT
CTTTTATCAGGTATGGTTTCGTCTCTCATCGTGCCTGTGTTTATTATCTGGCAACTGAATAAAACAGATG
TTGCTCTTTATGGTGACGCGAAGTTTGCCAGTGATAATGATTTAAGAAAATCGAAACTTCTGAAATGGGA
GAAAGAAAACGATACTGATATTCTCGTCGGGGCATATAAAGGTAAATACCTGTGGTATACCGCACCAGAT
TTTGTATCACTTGGCGCAGGAACCCGCGCAGGTAAAGGTGCCGCCATTGGTATCCCTAATCTTCTGGTCA
GAAAACACTCTCTGATTGCGTTAGATCCAAAACAGGAATTGTGGAAAATCACCAGTAAGGTGCGTGAAAT
ACTGCTGGGTAATAAAGTTTATCTGCTCGACCCTTTCAACAGTAAAACACACCAGTTTAATCCCCTTTTC
TATATTGATTTAAAAGCGGAGAGTGGGGCTAAGGATCTGCTTAAACTGATTGAAATTCTGTTTCCGTCTT
ATGGCATGACAGGGGCAGAAGCGCACTTTAATAATCTTGCGGGTCAATACTGGACAGGACTGGCTAAGTT
GCTTCATTTCTTTATTAACTATGAGCCGTCCTGGCTTAATGAGTTCGGGCTTAAACCCGTTTTCTCAATC
GGTTCTGTCGTCGACTTGTACAGCAATATTGACCGGGAACTGATACTCAGTAAGCGGGAAGAACTGGAGG
GAACAAACGGGCTTGATGAAAACGCGTTGTATCATTTGCGCGATGCCCTGACCAAAATCAGGGAATATCA
CGAAACGGAAGATGAACAGCGTTCAAGCATTGATGGTTCTTTCCGTAAGAAAATGAGCCTGTTTTATCTC
CCAACCGTTCGTAAATGTACTGATGGTAATGATTTCGATCTCCGTCAGTTGCGACGGGAAGATATCACTG
TTTATGTCGGTGTTAATGCGGAAGATATATCTCTGGCTTACGATTTTCTGAACCTGTTTTTCAACTTCGT
TGTTGAAGTGACATTGCGTGAAAATCCTGATTTTGATCCCACCCTGAAACATGACTGCCTGATGTTTCTT
GATGAGTTCCCTTCGATTGGTTATATGCCAATTATTAAAAAGGGATCAGGGTATATTGCAGGTTTTAAAC
TTAAACTGCTGACGATTTATCAGAATATCAGTCAGCTAAATGAAATCTATGGTATTGAGGGAGCCAAAAC
GCTGATGAGTGCTCATCCATGCCGTATTATCTATGCTGTCAGCGAAGAGGATGATGCCGCGAAGATATCA
GAAAAACTTGGATATATTACCACTACATCAAAGAGCACAAGCAAGAGCCGTGGACGGTCAACATCACAGG
GCGAATCAGAAAGTGAAGCCCGAAGAGCACTGGTGCTTCCACAGGAGCTGGGAACGCTGGACTTTAAAGA
AGAGTTTATCATCCTGAAGGGGGAGAGCCCTGTTAAAGCAGAAAAGGCACTTTATTACCTTGATCCGTAT
TTTATGGACAGATTAATGAAGGTCAGTCCTAAACTGGCATCATTGACGATGGAACTAAATAAGACGAAAA
AAATATTTGGTGTGAAAGGGCTTAAATATCCGTCAAAAGAAAAAATGCTCTCCGTAGGAGAACTGGAGTC
TGAGGTTTTATTATGA
 Primer design