SecReT4
Protein ID: 169303021
T4SS name [ID]VirB [455]
Gene symbolpilx11
Locus tagpOLA52_23
StrainEscherichia coli plasmid pOLA52 (NC_010378)
Repliconplasmid pOLA52 [GenBank: NC_010378] [Browse all T4SS(s) in this replicon]
Location [Strand]17991..19022 [-]
ProductPilx11 protein
Component typeVirB11
UniProt IDB0ZDX7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 3.7e-51, Aligned region: 25..312
Protein Sequence: 343 a.a.     [Download]
>gi|169303021|ref|YP_001693194.1| Pilx11 protein [Escherichia coli]
MNNENRHLIYDVVNDYFYHWLNEIDGVTEIAVNRPGEIFIKVRGKWQWYEQKMNYSDCLSFASTLADFHD
GGSVTPEYPLRSATLPGGERVQVVIPPATEKDTVSITIRKPSGIFISHDKFIKQGFYSRVGGLSGDSIME
DNISALITSEYFERVIPESLSQGKTIVFCGGTGSGKTTFANACLKYIPHHLRCISIEDTDEAKFRFHKNH
VKLYYPAEGESKVITSASLLRSCFRMNPDRILMTEIRGAEAWDFLKASSSGHAGNITTVHESSPESAVLG
IVQRCYMNPECQNLPFNVILRRVLSNIDIIMSIKYLDDEDFRFASGIYYKQLHFDDYFRKLKE
 
Nucleotide Sequence: 1032 bp     [Download]
>gi|169302998|ref|NC_010378.1|:c19022-17991 Escherichia coli plasmid pOLA52, complete sequence
GTGAATAACGAAAACAGACATCTGATTTATGATGTGGTCAACGATTATTTTTATCACTGGCTGAATGAGA
TTGATGGTGTCACGGAAATCGCTGTTAACCGACCAGGAGAAATATTTATAAAGGTCAGGGGAAAGTGGCA
ATGGTATGAACAAAAGATGAATTACAGTGATTGTCTTTCTTTTGCATCCACACTGGCTGATTTTCATGAC
GGTGGTTCTGTGACTCCTGAATATCCCCTGCGTTCCGCCACGCTTCCGGGTGGAGAACGTGTTCAGGTTG
TGATCCCACCGGCAACAGAAAAAGATACTGTTTCTATAACAATCCGTAAGCCGTCAGGTATTTTTATCAG
TCATGACAAATTTATAAAACAGGGGTTTTATTCACGCGTCGGTGGTTTAAGTGGTGATTCCATTATGGAA
GATAATATTTCTGCTTTAATCACTTCCGAATATTTTGAACGGGTTATACCTGAATCACTGAGTCAGGGGA
AAACGATAGTTTTCTGTGGAGGGACGGGGTCTGGTAAAACTACCTTTGCAAATGCCTGTCTGAAATATAT
ACCGCATCATCTGCGGTGTATTTCTATTGAAGATACTGATGAAGCAAAATTCAGATTCCATAAAAACCAT
GTAAAACTTTACTATCCGGCAGAGGGTGAGAGTAAGGTTATTACCTCAGCGAGTCTTCTGCGTTCCTGTT
TTCGTATGAATCCGGACAGGATTCTGATGACAGAAATCAGGGGGGCTGAGGCATGGGATTTTCTGAAAGC
ATCGAGTTCAGGCCATGCAGGAAACATCACCACCGTTCACGAAAGTAGTCCTGAATCTGCCGTGCTTGGG
ATTGTCCAGCGATGTTATATGAATCCTGAATGTCAGAATCTACCATTCAATGTCATTTTAAGACGTGTAC
TGAGTAATATTGATATTATCATGAGTATTAAATACCTTGATGATGAAGATTTTCGGTTCGCTTCCGGTAT
TTACTACAAACAACTTCATTTTGATGACTATTTCAGAAAACTGAAGGAGTGA
 Primer design