SecReT4
Protein ID: 169303024
T4SS name [ID]VirB [455]
Gene symbolpilx8
Locus tagpOLA52_26
StrainEscherichia coli plasmid pOLA52 (NC_010378)
Repliconplasmid pOLA52 [GenBank: NC_010378] [Browse all T4SS(s) in this replicon]
Location [Strand]21160..21873 [-]
ProductPilx8 protein
Component typeVirB8
UniProt IDB0ZDY0, B7LJC6
KEGG IDeum:p2ECUMN_0026
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2e-47, Aligned region: 19..234
Protein Sequence: 237 a.a.     [Download]
>gi|169303024|ref|YP_001693197.1| Pilx8 protein [Escherichia coli]
MEFKLPGFKNKKDVTDSSVSFEEKNIALQERMNRIYKFGGIGGMLIGGLSLLALNAALPLKTTVVDAYLI
DKVTGVAERLTSVKKENLSENEAIARYFITQYIKHREGYNFFSLQHDYDYVMAYSAENVAADYNALFNSE
QAPKLVYNKAEKTAMVQDNPSVIISPSSRTDDKDIGAYIRFRLTIRDVATGQTRQEFWNVRLTYRIEPQV
EMVSGERNNNPLKFVVTSYVRDKEARG
 
Nucleotide Sequence: 714 bp     [Download]
>gi|169302998|ref|NC_010378.1|:c21873-21160 Escherichia coli plasmid pOLA52, complete sequence
ATGGAATTTAAACTTCCCGGATTTAAAAATAAAAAAGACGTTACTGACTCATCAGTTTCGTTTGAAGAAA
AAAACATTGCACTACAGGAGAGAATGAATCGTATTTATAAATTCGGTGGTATCGGAGGCATGTTAATTGG
TGGGCTGTCTTTACTTGCATTAAATGCAGCATTACCACTGAAAACAACAGTTGTTGATGCCTACCTTATC
GATAAGGTTACAGGTGTGGCTGAACGTCTGACTTCTGTTAAAAAAGAAAATCTTTCTGAAAACGAAGCCA
TTGCCCGATATTTTATCACCCAGTATATAAAACATCGTGAAGGTTATAATTTTTTCAGTCTCCAGCATGA
TTATGATTATGTAATGGCTTACAGCGCGGAGAATGTCGCTGCAGATTATAACGCATTATTTAACAGTGAA
CAGGCACCAAAACTTGTTTATAACAAAGCAGAAAAAACGGCAATGGTTCAGGATAATCCATCTGTCATAA
TTTCACCTTCGTCACGGACGGATGATAAAGATATCGGTGCGTATATTCGTTTTCGTCTGACCATCAGGGA
TGTTGCTACCGGACAAACCCGCCAGGAGTTCTGGAATGTTCGCCTGACTTATCGTATCGAACCGCAGGTT
GAAATGGTGTCAGGGGAACGTAATAACAATCCTCTTAAGTTCGTTGTAACAAGCTACGTTCGCGATAAAG
AAGCCAGAGGTTAA
 Primer design