SecReT4
Protein ID: 169303025
T4SS name [ID]VirB [455]
Gene symbolpilx7
Locus tagpOLA52_27
StrainEscherichia coli plasmid pOLA52 (NC_010378)
Repliconplasmid pOLA52 [GenBank: NC_010378] [Browse all T4SS(s) in this replicon]
Location [Strand]21863..21991 [-]
ProductPilx7 protein
Component typeVirB7
UniProt IDB0ZDY1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 42 a.a.     [Download]
>gi|169303025|ref|YP_001693198.1| Pilx7 protein [Escherichia coli]
MKLLIVAFVTLCLAGCQASHKLPPVSGKSEPVNSAEVMQNGI
 
Nucleotide Sequence: 129 bp     [Download]
>gi|169302998|ref|NC_010378.1|:c21991-21863 Escherichia coli plasmid pOLA52, complete sequence
ATGAAACTACTTATTGTGGCTTTCGTGACGCTTTGTCTCGCTGGTTGTCAGGCGTCACATAAACTACCGC
CCGTTTCCGGGAAAAGCGAACCTGTTAATTCTGCTGAGGTAATGCAAAATGGAATTTAA
 Primer design