SecReT4
Protein ID: 169544195
T4SS name [ID]Tra_F [806]
Gene symboltraD
Locus tagpYE854_p029
StrainYersinia enterocolitica plasmid pYE854 (NC_010377)
Repliconplasmid pYE854 [GenBank: NC_010377] [Browse all T4SS(s) in this replicon]
Location [Strand]15280..17352 [+]
Producthypothetical protein
Component typeTraD_F
UniProt IDB0RKL6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 6.6e-106, Aligned region: 180..565
TraG-D_C [PF12696], Evalue: 2.1e-16, Aligned region: 423..544
T4SS-DNA_transf [PF02534], Evalue: 1.8e-11, Aligned region: 337..551
AAA_10 [PF12846], Evalue: 1.1e-09, Aligned region: 195..504
Protein Sequence: 690 a.a.     [Download]
>gi|169544195|ref|YP_001692970.1| hypothetical protein pYE854_p029 [Yersinia enterocolitica]
MLDRKKNDGSLVELTRGGQTLTHFLRMLYQILSRYIKIVLLAYVIGSVGIGYFLSSETDLKMGSQYAISA
FRVEYLLDKNVKTQLILPSGKSVTVTHGQIVSSPTMKNHFEIIKGKIYLGAIASLFLSALVAVFLFRYLR
KRGKNDAKDEHIRGAAIGNKEELISAVKEKLKTAHLPSRYSLNNVPLLPAQECTSILLAGSPGVGKSTVI
RDILRQGRIHNDKAVIYDISGEFTKRFYRKGFDVILNPFDKRTHSWTLWNEGRNEIAYNRLSQAAIPPVD
KGDPFWSMAPQLVFSSIMDELGNRSETPSHEHLMNIILRMSDDKLAQVVAHQDARTVFNLDVEKMAGSLR
AVITAYTRNLKYLSHMTGPQFSFRDWARNEDDRRWVFLTVRDDLKVTMMSALTMWIESACSAILSLEPSD
VRRILCAFDEIPTLHPIPSLLDFSGTGRKFGAVPILGFQSNSQLLEKYGEHRTKTLTDAAGVFMGFSIKG
SDGASWIAKQLGNSEIEEATENFSIGAADVRDTTNVNRTTQERELLLYSQIQGLEDLHCLIRMGNGLPVT
KLEYKHDNMPTIANAIEETDIFKAQTFQTEFHIEKETDAKSTVEGVIKHAKANNINDLLSWEAHKAIKEK
QDAARKQATTGNSSTTDSDSENKPFNSPQNKIEEAISKAAEEVNKNASPSITIDTFKFGD
 
Nucleotide Sequence: 2073 bp     [Download]
>gi|169544164|ref|NC_010377.1|:15280-17352 Yersinia enterocolitica plasmid pYE854, complete sequence
ATGTTAGATAGAAAGAAAAATGATGGTTCTTTAGTTGAGTTGACAAGAGGGGGACAAACACTAACTCACT
TCTTGAGAATGCTTTACCAAATACTTTCGAGATATATAAAAATTGTTTTATTGGCGTATGTCATCGGTAG
TGTTGGTATAGGTTATTTTCTCTCATCTGAGACGGATTTGAAGATGGGATCTCAATATGCAATATCAGCA
TTTCGAGTTGAATATTTGCTGGATAAAAATGTGAAAACACAATTGATTCTGCCTAGTGGTAAATCAGTGA
CGGTTACGCACGGGCAAATTGTTAGCAGTCCAACAATGAAGAACCACTTTGAGATTATCAAGGGGAAAAT
TTACTTAGGTGCCATTGCATCATTATTTTTATCAGCGCTAGTTGCAGTGTTTTTGTTTCGGTACTTAAGA
AAGAGAGGTAAGAATGATGCTAAAGATGAGCATATAAGAGGGGCCGCTATAGGCAATAAAGAAGAACTGA
TCTCAGCTGTGAAGGAGAAATTGAAAACAGCACATTTGCCAAGCCGATACTCACTTAATAATGTTCCGTT
ACTTCCCGCGCAGGAGTGTACAAGCATTCTTTTAGCTGGCTCACCAGGGGTAGGTAAATCAACGGTAATT
AGAGACATATTACGGCAGGGACGCATCCATAATGACAAAGCCGTCATCTATGATATTTCGGGGGAGTTTA
CCAAACGATTTTATCGCAAAGGCTTCGACGTAATATTAAATCCATTCGACAAACGTACTCATTCTTGGAC
TTTGTGGAATGAGGGAAGAAATGAAATTGCTTACAACCGGTTATCCCAGGCTGCTATTCCTCCGGTTGAT
AAAGGTGATCCATTTTGGTCTATGGCACCTCAATTAGTGTTTTCATCCATAATGGATGAGTTAGGTAATC
GCTCAGAAACACCTTCCCATGAGCATCTTATGAATATTATTCTACGGATGAGCGATGACAAGCTGGCACA
GGTCGTTGCTCATCAGGATGCAAGGACAGTATTCAACCTTGATGTTGAGAAAATGGCGGGTTCACTCAGA
GCGGTAATAACTGCATATACTCGCAATTTGAAATACCTTTCACATATGACAGGGCCGCAATTTTCTTTTA
GAGATTGGGCGCGTAATGAAGATGATAGACGCTGGGTATTCCTAACTGTCAGAGATGATTTAAAAGTAAC
TATGATGTCTGCTTTAACCATGTGGATAGAGTCTGCATGTTCAGCAATTCTCTCTCTCGAACCATCTGAT
GTGCGTCGAATTCTTTGTGCTTTTGACGAAATACCGACACTACATCCAATCCCTTCATTACTTGATTTTT
CAGGCACAGGAAGAAAATTTGGTGCTGTACCAATTCTTGGGTTTCAGAGTAATAGCCAACTATTAGAGAA
ATATGGCGAACATAGAACTAAGACATTAACAGATGCAGCCGGTGTATTTATGGGCTTTAGCATTAAAGGT
TCTGATGGTGCCAGTTGGATTGCAAAACAACTTGGTAATAGTGAAATTGAAGAAGCAACAGAGAACTTTT
CAATTGGTGCAGCAGATGTTCGTGATACTACCAATGTTAATAGAACGACACAAGAACGTGAACTGCTTCT
TTATAGTCAAATTCAAGGTCTGGAAGATTTGCACTGCCTAATAAGAATGGGGAATGGTTTACCGGTAACC
AAACTTGAATATAAACACGACAACATGCCTACAATTGCTAATGCGATAGAGGAAACGGATATATTTAAAG
CACAAACATTCCAGACTGAGTTCCATATAGAAAAAGAGACAGATGCGAAGAGCACTGTTGAAGGGGTTAT
TAAGCATGCGAAAGCAAATAACATCAATGATCTTTTAAGCTGGGAAGCACATAAGGCCATAAAAGAAAAA
CAAGATGCAGCTCGCAAACAAGCGACAACAGGCAATTCATCGACGACAGATAGTGACTCAGAAAACAAAC
CGTTTAACTCCCCACAAAATAAAATTGAAGAAGCAATATCAAAAGCAGCCGAAGAGGTAAATAAGAACGC
CTCCCCATCAATTACCATCGATACTTTTAAATTTGGAGACTAA
 Primer design