SecReT4
Protein ID: 169544201
T4SS name [ID]Tra_F [806]
Gene symboltraI
Locus tagpYE854_p034
StrainYersinia enterocolitica plasmid pYE854 (NC_010377)
Repliconplasmid pYE854 [GenBank: NC_010377] [Browse all T4SS(s) in this replicon]
Location [Strand]17353..22323 [+]
Productmobilization protein TraI
Component typeTraI_F
UniProt IDB0RKM2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrwC [PF08751], Evalue: 4.9e-79, Aligned region: 9..289
AAA_30 [PF13604], Evalue: 1.1e-61, Aligned region: 499..681
AAA_30 [PF13604], Evalue: 1.1e-61, Aligned region: 1108..1285
UvrD_C_2 [PF13538], Evalue: 4.7e-10, Aligned region: 827..926
Viral_helicase1 [PF01443], Evalue: 5.7e-10, Aligned region: 520..627
AAA_19 [PF13245], Evalue: 8.2e-06, Aligned region: 511..572
Protein Sequence: 1656 a.a.     [Download]
>gi|169544201|ref|YP_001692976.1| mobilization protein TraI [Yersinia enterocolitica]
MLSLKKIGNVKEAGNYYLSHDSYYNKDTGEVHSEWGGKGAEELGLSGAVDTDRFIELLEGKIKADIQLGR
TKVNGDLEHVPGWDFTFSAPKGASILALVGDDKRLIQAHQESVIEAMKFLEKNYAATRTYKDGKTHLEKV
DNLLYASFIHTESRSHDPQLHTHNPVINAVLDSEGKWKSLEPVEMYRAKMMAGLVYRSSYASKARGLGYE
IEVTDREKGFFDIKGIPDPLKGSFSKRRQQIQAAINQRGLFDQKSIEKATLFTRDKKTSIAQEERNEIWK
TTVTESGFDIDLFISNAKEQQIQQQNRGERDIHDNNGIESPAPESKTESTSKTKERPEAKESFYENHKEQ
SEAFAEKGDTTDFLSQQEHIHLEESRHFDYDSQSLNDVRLAYKVLAENESVFSYKALLKEAMKLRLGLEN
SSKADIDLDIDRLIDVGELIPRKTGFTTKEALSRERFIVTTMLNGKDTYQAIGDLKGVKTHIDAFEQRQT
ELLGQKFTFSDDQRQAIQDMLLSKDLVSGIQGYAGTGKTTLLSCVIEYATNQGYIIKGLAPTGSAVETLH
KDTGIVTSTVDSYLFTRKPEDIESKQIILVDEGSLLNAKHVQDLLIAAKNSGAKLFLLGDKDQHAAVEAG
KPFIIMQAFGMQVASVKTIIRQKNEELLNAVKDAINNNFSESLNWMGKNVDVDENPLGKMATEWLSLTSE
ERGKTLVIIPENKTRRKYNSTIRRELQEEGVVSKDEISTRVLLNSRMNHAKMRDTRYYKTEHLIEFQKET
QGIKPGFYKITLFNHLDNELTISSDNKDVHVFRPGELDEKDRYQLDVFEEENLKISKGDKLQWTKSRKGL
GLKNGDMLEVISTDSSKGTYQAIRENDGQIFELDANQRLNVDYSYSLTSYKAQGKTCDRVYALLVASKNK
LVNNKSFYVSISRAKHIAKIFTDNKAKLLDAINKKDSDKTTALEGFSTGQMKREANDEKNIPKDNRKLHQ
AIMEVKTASEKLSAKQAVFSHTDLLKEAMKWTLGIYDANDISDAIAHLRQEGNLALSSIQKKGEGSEHYY
TSRNNVLIERELVVHLQQGKGRLAKLAPKGVIKSYVDSRNERALSEDIMPINESSLFALETIFNSKDEGI
LVLGSDNTGHKNLLRTVGKSIAEHQEYKVHAFSTNNTGVKQMKDDGMKNAMSIFSHMDRIEASIAKGEPL
KGRRQLWYVENISTLGAEETLRLQRLARFSGARLIMVADKNENALSWGAVPALLNHHGMHTVNFNATVMA
HNPEINKASDALVKGRIEESLSALSPMVHEVDSQIKAEAKIARIGVVKDTYLNLSTEERAQTAIILPDHH
TRHAVNSMIREGLKAEKSLAYNGTETTVYRQVTLDPFEKKEARFYKVGMVLESESTTQNGTKGDKFTIVD
VDKKNNILEIKSLAEGKILSIKTKDIPTSKGNGFISYAVENREIVKGERIRLTRAFPLPKKKQTDKGGYL
PKNTEAIVKDINVSTGDLILTLNNGQQITLNAQQWKHYEWGYTYNHYQVKDSAYKQVITIMESWKKNFAT
QNALHNTLSRSTHNLIVITDNKEKLFDTLRANTGFQKMALDNKKVSVTQADIKNFDELWGKSLSPFEKRI
TRLELAVSKAVSKFVEVTAKKEIKTPEFPNKNQQPEKNRPTKQRSL
 
Nucleotide Sequence: 4971 bp     [Download]
>gi|169544164|ref|NC_010377.1|:17353-22323 Yersinia enterocolitica plasmid pYE854, complete sequence
ATGCTCAGTCTTAAAAAAATAGGTAATGTTAAAGAGGCGGGTAATTACTATCTTAGCCATGATAGTTATT
ATAATAAAGATACTGGCGAAGTTCACAGTGAGTGGGGAGGTAAGGGGGCTGAAGAGTTAGGTTTGTCAGG
GGCTGTCGATACAGATAGATTTATAGAATTACTTGAAGGAAAAATAAAAGCTGATATTCAGCTCGGGCGC
ACGAAAGTTAATGGAGATTTAGAACATGTACCAGGTTGGGATTTTACATTCAGTGCTCCCAAAGGTGCTT
CTATATTAGCCTTGGTGGGGGATGATAAAAGGCTTATTCAGGCCCATCAGGAAAGTGTCATTGAAGCAAT
GAAATTTCTTGAAAAGAATTATGCTGCTACTCGAACGTATAAAGACGGGAAAACTCACCTAGAGAAAGTA
GATAATCTTTTATATGCATCTTTTATACATACCGAGTCAAGATCTCATGACCCTCAATTGCATACGCATA
ATCCAGTAATTAATGCAGTCCTTGATAGCGAAGGAAAATGGAAGAGCCTAGAGCCGGTAGAAATGTACCG
TGCAAAGATGATGGCGGGACTGGTGTACCGTTCTAGCTATGCTAGTAAGGCAAGAGGCTTAGGATATGAA
ATTGAAGTCACTGATAGGGAAAAAGGCTTCTTTGATATCAAAGGTATCCCCGATCCATTAAAGGGGTCTT
TTTCAAAGAGACGGCAACAAATACAAGCTGCAATAAACCAAAGGGGGCTATTCGATCAAAAATCCATCGA
GAAGGCTACGTTATTTACCCGTGATAAGAAAACATCTATTGCTCAAGAAGAACGTAATGAAATTTGGAAA
ACTACAGTCACAGAATCTGGTTTCGATATTGATTTATTTATAAGTAATGCCAAAGAGCAGCAAATTCAAC
AGCAGAACAGGGGGGAGCGTGATATCCATGATAACAACGGAATCGAGTCACCGGCCCCTGAAAGCAAAAC
AGAGTCAACAAGCAAGACAAAAGAACGACCGGAGGCAAAGGAATCCTTTTATGAAAATCATAAAGAGCAA
TCTGAAGCTTTTGCAGAGAAGGGAGATACAACCGATTTTTTATCACAACAAGAGCACATACACTTAGAAG
AGAGCAGACACTTTGACTACGATAGCCAAAGTCTAAATGACGTTAGATTAGCCTATAAGGTTTTAGCTGA
AAATGAGTCTGTATTCTCATATAAAGCGTTGCTGAAAGAAGCGATGAAATTGAGGCTTGGGTTGGAGAAC
TCTAGCAAAGCCGACATTGATTTGGATATTGACAGACTAATTGATGTAGGTGAGTTAATTCCAAGAAAGA
CTGGTTTTACAACAAAAGAAGCGCTCAGCCGTGAGCGTTTCATAGTAACAACTATGCTCAATGGTAAGGA
TACTTATCAAGCAATTGGTGACTTAAAAGGAGTTAAGACTCACATAGATGCATTTGAACAAAGACAAACA
GAATTATTAGGACAAAAATTTACTTTCTCAGATGATCAGCGTCAAGCTATCCAGGATATGCTTTTGAGCA
AGGATCTTGTTAGCGGTATTCAAGGATACGCGGGTACGGGGAAAACAACATTACTATCATGTGTTATTGA
ATACGCTACTAACCAGGGATACATAATTAAAGGGCTTGCACCAACAGGTTCAGCGGTGGAAACACTTCAT
AAAGATACAGGGATAGTAACATCAACAGTAGATAGTTACTTGTTTACTCGTAAACCTGAAGATATAGAAA
GTAAACAAATAATATTGGTAGATGAGGGTAGTCTTTTAAATGCAAAGCATGTTCAAGATTTGCTTATAGC
AGCTAAAAACTCAGGGGCTAAATTATTCCTGTTAGGCGATAAAGATCAACACGCGGCAGTAGAGGCGGGC
AAACCATTCATTATTATGCAGGCATTTGGGATGCAGGTAGCAAGTGTTAAGACTATCATTCGCCAAAAAA
ATGAAGAATTACTTAATGCTGTGAAAGATGCAATAAATAATAACTTTTCTGAATCACTAAATTGGATGGG
TAAAAATGTAGATGTTGATGAAAATCCGCTTGGAAAAATGGCAACGGAATGGCTATCACTCACTAGTGAA
GAGAGAGGAAAAACATTAGTTATAATTCCAGAGAATAAAACAAGACGCAAATATAACTCAACAATAAGAA
GAGAATTACAAGAGGAAGGTGTTGTTTCTAAGGATGAGATATCTACCAGAGTTTTATTAAATTCAAGAAT
GAATCACGCTAAAATGCGTGACACAAGATATTATAAAACAGAACATCTGATAGAGTTTCAAAAAGAAACC
CAAGGAATTAAACCTGGATTTTATAAAATAACACTTTTTAATCACCTGGATAATGAATTAACGATTAGTT
CTGATAACAAAGATGTTCATGTTTTTAGGCCAGGAGAGCTAGACGAAAAAGATAGATATCAGCTTGATGT
ATTTGAGGAGGAAAACCTAAAAATATCAAAGGGTGACAAGTTGCAATGGACTAAATCAAGAAAAGGACTA
GGTTTAAAAAATGGAGATATGCTAGAAGTTATTAGTACGGATAGTAGTAAAGGAACATATCAGGCGATTA
GAGAGAACGATGGGCAGATATTTGAACTTGATGCAAACCAACGTTTGAATGTTGATTATAGCTATTCACT
TACATCCTATAAAGCGCAAGGTAAAACATGTGATCGTGTGTATGCATTATTAGTCGCAAGTAAAAATAAA
TTGGTTAATAATAAGTCATTTTATGTATCAATATCCCGAGCTAAGCATATCGCAAAGATTTTCACAGATA
ATAAAGCTAAGTTGCTCGATGCTATAAATAAGAAAGATAGTGATAAAACAACGGCACTGGAAGGCTTTTC
TACAGGTCAGATGAAAAGAGAGGCTAATGATGAGAAGAATATACCGAAGGATAATCGGAAGCTTCACCAA
GCTATTATGGAGGTAAAAACAGCTTCCGAGAAACTATCAGCTAAACAAGCGGTATTTAGTCATACCGACT
TACTCAAAGAAGCGATGAAATGGACACTCGGTATTTATGATGCCAACGATATTAGTGATGCAATAGCTCA
TCTACGCCAGGAAGGTAATTTAGCTTTGTCTTCAATTCAAAAAAAAGGAGAAGGGTCTGAACACTATTAT
ACCTCAAGAAATAACGTTCTTATTGAACGTGAGTTAGTCGTCCATCTTCAGCAAGGGAAAGGGAGGTTAG
CAAAATTAGCACCTAAAGGTGTGATTAAGAGCTATGTAGACTCAAGGAATGAACGCGCATTGTCTGAAGA
TATTATGCCAATAAATGAGAGTTCTTTGTTTGCTCTTGAAACTATATTCAATAGCAAAGATGAAGGAATT
TTAGTTCTAGGTTCTGATAATACAGGCCACAAGAATTTACTACGAACTGTAGGTAAGTCGATTGCAGAGC
ACCAAGAATACAAAGTTCATGCTTTTAGTACCAATAATACAGGGGTGAAGCAGATGAAAGATGATGGCAT
GAAGAATGCCATGTCTATTTTTTCTCATATGGATCGAATAGAGGCAAGCATTGCTAAAGGAGAGCCGCTT
AAGGGGCGTAGGCAGCTTTGGTATGTAGAGAACATATCAACATTAGGGGCAGAGGAAACGCTTCGCCTAC
AGCGACTGGCGCGTTTCTCTGGGGCAAGGTTGATTATGGTAGCCGACAAAAATGAAAATGCGTTGTCTTG
GGGGGCTGTACCGGCTCTACTAAACCATCACGGAATGCATACAGTTAACTTTAATGCAACTGTGATGGCA
CATAATCCCGAAATTAATAAAGCGTCAGATGCCTTAGTGAAAGGCAGGATAGAAGAGTCCCTCTCTGCTC
TATCACCAATGGTTCATGAAGTTGATAGCCAGATAAAGGCCGAGGCAAAAATAGCGCGAATAGGCGTGGT
TAAAGATACCTATCTCAACCTCAGTACGGAGGAACGAGCACAAACAGCGATTATTTTACCCGATCATCAT
ACGCGGCATGCAGTAAACAGTATGATAAGGGAGGGATTAAAAGCCGAAAAATCACTTGCCTATAATGGAA
CTGAAACTACTGTGTATCGCCAGGTTACTTTAGATCCCTTTGAGAAGAAGGAAGCTAGATTCTATAAAGT
AGGCATGGTATTAGAATCGGAATCAACTACGCAGAATGGAACTAAAGGTGATAAATTCACAATTGTAGAT
GTGGATAAGAAAAATAATATCTTAGAAATAAAATCTTTAGCTGAAGGTAAAATATTAAGTATTAAAACAA
AGGATATCCCAACAAGTAAGGGGAATGGATTCATTTCATATGCAGTAGAAAATAGAGAAATTGTTAAGGG
TGAACGAATTAGGCTCACCAGAGCGTTTCCATTGCCAAAGAAAAAGCAAACAGACAAAGGAGGGTATCTG
CCAAAAAATACTGAAGCCATAGTTAAGGATATTAATGTAAGCACGGGGGATTTAATCCTGACATTAAACA
ATGGACAGCAAATAACATTAAACGCACAGCAATGGAAACACTATGAATGGGGATATACTTATAATCATTA
TCAGGTAAAAGATTCTGCATACAAACAAGTTATTACTATTATGGAATCATGGAAAAAAAACTTTGCTACG
CAAAATGCCTTACATAACACGTTATCGCGTTCTACACACAACCTGATTGTTATTACAGATAATAAAGAAA
AGCTATTTGATACACTGAGAGCAAACACAGGCTTTCAGAAAATGGCACTAGATAATAAAAAAGTATCTGT
AACTCAGGCTGACATTAAGAATTTTGATGAGCTATGGGGAAAGTCACTTAGTCCGTTTGAGAAGAGAATT
ACACGCTTAGAGTTAGCTGTTAGTAAGGCCGTATCGAAGTTTGTAGAAGTTACAGCCAAAAAAGAGATTA
AGACTCCTGAGTTTCCGAATAAAAATCAGCAACCGGAAAAAAATAGACCAACTAAACAACGGTCATTATG
A
 Primer design