SecReT4
Protein ID: 169544208
T4SS name [ID]Tra_F [806]
Gene symbolpilT
Locus tagpYE854_p040
StrainYersinia enterocolitica plasmid pYE854 (NC_010377)
Repliconplasmid pYE854 [GenBank: NC_010377] [Browse all T4SS(s) in this replicon]
Location [Strand]23568..24200 [-]
Productputative transglycosylase PilT
Component typeOrf169_F
UniProt IDB0RKM9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 210 a.a.     [Download]
>gi|169544208|ref|YP_001692983.1| putative transglycosylase PilT [Yersinia enterocolitica]
MRKLILASLFSSSFLIPLPSYAFMDCFISAGQQYGVSPLLIQAIAEGESKYNNRAINLKNSDRTTDATMM
QINSWWHDKPVFTDNKLSRQKLMKDPCLSINFGAWVLAGNFSIGGVNWNSVGAYNAGWKKNKATARQNYV
NKIRPIYERLKRESGVSPSSPEMNDSNLGTLTAELSPRSPNHNGSSLNTELVTKSFFHSRDIDMKLVGGM
 
Nucleotide Sequence: 633 bp     [Download]
>gi|169544164|ref|NC_010377.1|:c24200-23568 Yersinia enterocolitica plasmid pYE854, complete sequence
ATGAGAAAATTAATATTAGCCTCTTTATTTTCTTCTTCGTTTTTAATTCCCCTTCCAAGTTACGCATTTA
TGGACTGCTTCATAAGTGCCGGACAACAGTATGGCGTATCGCCATTGTTGATCCAGGCAATTGCGGAAGG
TGAGTCTAAGTATAACAATCGCGCCATAAACTTGAAAAACTCAGATAGAACAACTGACGCCACTATGATG
CAAATTAATTCTTGGTGGCATGATAAACCGGTTTTCACAGATAACAAGCTTAGTAGACAAAAACTAATGA
AAGATCCGTGCCTTAGTATAAATTTTGGGGCGTGGGTTCTTGCGGGTAATTTTTCTATCGGTGGCGTGAA
TTGGAACTCCGTGGGAGCCTATAACGCTGGTTGGAAGAAAAACAAGGCAACAGCCAGGCAAAACTATGTT
AATAAAATTAGACCCATCTATGAGCGCCTAAAACGTGAGTCTGGCGTCTCACCATCCTCACCAGAAATGA
ATGACTCAAATTTAGGCACACTTACTGCCGAATTATCCCCTCGTTCTCCTAACCATAACGGATCAAGCTT
AAATACAGAACTTGTCACTAAATCATTTTTTCATTCAAGGGACATCGATATGAAACTAGTAGGTGGTATG
TGA
 Primer design