SecReT4
Protein ID: 169544302
T4SS name [ID]Tra_F [806]
Gene symbol-
Locus tagpYE854_p129
StrainYersinia enterocolitica plasmid pYE854 (NC_010377)
Repliconplasmid pYE854 [GenBank: NC_010377] [Browse all T4SS(s) in this replicon]
Location [Strand]54838..58491 [-]
Productexoprotein
Component typeTraG_F
UniProt IDB0RKY1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 1217 a.a.     [Download]
>gi|169544302|ref|YP_001693077.1| exoprotein [Yersinia enterocolitica]
MKPYLLLLIILIPSVSFASLDMEYVVQGGFSTVVNAFTRIKFMFNDRQYSSLMAAMVVFGIVSGLMYRAA
KGSIELLETGKGNMGLGWLAYTLIGTMIWFGLMVPKGTIHIYDQTRNQYQPVSGIPDFITLVAGGTNLIY
QAFTNMANTNTATTTRFSGEGMPIKVLMALMTRNGASFDPYISKSITEMWRQCSPVAETRGFDANNLKTG
NTTFNIVTTLSALRNPAVFTTWYSAADPGGSTVSCTTAYSNLQSAMGSPTTYDSRLKDICSKLGYNSANA
ASYVDCKGRMEDTLQTVYGNTTLTLNAAIGGVMVSQAISDALVQQNPEVAGTMLANRSMVNSALSDASTN
PEWLTTIMAGVMAIILSMTPMLILLVVTPLMGKALTLLLGMWIFLTAWQVADTLLLQASTDEILTVMSEV
KSMGFGLDAMQLAPTSAQKAMTVLASARTNAIYIATLFAGLFGVSAYGLTSFAGKSMQQLDRASNESERS
LTNEGRGGLIEGAKSGLASQKAYADIGDIDMMARGSATGELSSIKSNNAQVDALGGDLSSATTRMSQVSA
GAAAGNVRGTEQATQPGQSAFTAASESSSVSTQGEIGRNRGVEDSASAMNMSVTDQAAYNSAIGKSTETG
EAKGTEQAFGSLDNIGNKTAFNTAVSKATQAGESKGVMDAAGNNLSNVESRQSEISSVRSAENIGEARGT
KDAFGSLSGIESSTQFNTGESKAQGLVDNQRQRDQVETISAETGSTIPEARRHLSDANSAPVQASLAANG
YDGQKVIDTATYDAQQHVASQHGERAAFAEQGVVPQEVAGYTGYKEGFNTVASNETNRKLSDAMDGEDNR
ARAEAGANHHMALNKDNAEGLHKAGIINEEQLNSLDSGGRADFSMISGKDGNVTGTSAVHSGQSTSADSS
ATYNSQSSINQGLDAGSAVSQRNQLSTKEGVRNLIDQSERNSPKSGQFINDLAHFSAESLTPFTNSTKMD
SVHQSASTSLTGGTPGSGILGFGASATTTVEGSTTDQDHYNQRAGQFKHQLESMSQAGMAEADKQGLHGA
DKDNYVKDYVADNYSQYYQQEYRNSANETMKESSGSAQAGRDKDYNQQNGLYSQPGTYTAPDNYRSLSAQ
ENAHIRSQQGEGQLASDKFEYGQVPQQTTSVSSSGEPETIVREVKVQAPPRVSADTSSSEIQPSQGMAQQ
SSTSPSTMPPVKGETRSKSDMPPVGKK
 
Nucleotide Sequence: 3654 bp     [Download]
>gi|169544164|ref|NC_010377.1|:c58491-54838 Yersinia enterocolitica plasmid pYE854, complete sequence
ATGAAGCCCTATCTGTTGCTACTCATCATCCTGATTCCTAGTGTTAGTTTCGCATCTCTGGATATGGAGT
ACGTCGTCCAAGGCGGTTTCTCTACTGTTGTTAATGCCTTTACACGTATTAAGTTCATGTTTAATGACCG
CCAATACTCATCATTGATGGCGGCAATGGTGGTATTTGGGATCGTTTCTGGACTCATGTACCGCGCAGCC
AAAGGAAGCATAGAACTACTAGAAACCGGCAAGGGTAATATGGGGCTAGGTTGGTTAGCTTACACCTTGA
TTGGTACGATGATATGGTTTGGTTTGATGGTGCCGAAAGGCACCATACATATTTATGATCAGACTCGTAA
CCAGTACCAGCCGGTAAGCGGAATTCCCGATTTTATAACCTTGGTCGCCGGTGGGACGAACCTGATTTAT
CAGGCATTTACTAACATGGCGAATACCAACACAGCCACGACCACGCGTTTCAGTGGTGAAGGAATGCCAA
TCAAGGTGCTGATGGCGCTCATGACACGCAACGGCGCATCATTTGATCCCTATATCAGTAAATCAATAAC
CGAAATGTGGCGACAATGTTCACCGGTTGCTGAAACCAGAGGGTTTGACGCTAATAATTTAAAGACCGGT
AATACTACATTTAATATCGTCACCACGTTAAGCGCTCTGCGTAATCCTGCGGTCTTTACTACCTGGTACT
CAGCAGCTGACCCTGGAGGTTCAACCGTAAGTTGCACCACGGCCTACAGTAATCTTCAAAGCGCTATGGG
TTCCCCAACAACCTACGATTCTCGGTTGAAGGATATCTGTTCCAAATTAGGATATAACTCCGCAAATGCG
GCTTCATATGTCGATTGTAAAGGACGGATGGAAGACACATTGCAGACTGTGTACGGAAACACCACCCTGA
CTCTTAACGCCGCGATCGGGGGGGTTATGGTATCTCAAGCAATCAGTGATGCCTTAGTACAACAAAACCC
TGAAGTAGCCGGAACAATGTTGGCTAACCGCTCAATGGTTAACTCGGCGTTATCGGATGCTTCAACCAAT
CCAGAGTGGCTAACAACCATAATGGCTGGGGTGATGGCAATTATCCTTTCCATGACGCCGATGCTAATAC
TTCTGGTTGTCACTCCCTTGATGGGTAAAGCATTAACTCTATTACTCGGCATGTGGATATTTCTTACTGC
GTGGCAAGTAGCAGATACGCTGTTGTTGCAAGCCTCCACTGATGAAATTCTAACGGTGATGTCGGAAGTA
AAATCAATGGGCTTCGGCTTGGATGCTATGCAATTAGCGCCAACCAGTGCACAAAAAGCCATGACAGTTC
TAGCTTCGGCCCGAACTAACGCAATCTATATTGCGACATTGTTTGCTGGGCTTTTCGGGGTAAGTGCATA
TGGACTTACATCATTCGCGGGCAAGTCGATGCAACAACTTGATCGGGCCAGTAATGAATCAGAAAGAAGC
CTTACTAATGAAGGTCGCGGTGGACTGATTGAAGGCGCGAAATCAGGGCTGGCTTCGCAGAAAGCCTATG
CTGATATTGGTGATATCGACATGATGGCCAGAGGATCGGCAACTGGTGAGCTAAGTTCAATTAAATCGAA
TAATGCACAAGTTGATGCACTCGGTGGCGATCTCAGTTCAGCAACCACAAGAATGAGCCAAGTAAGCGCC
GGTGCTGCTGCTGGTAATGTGCGGGGAACAGAGCAAGCCACACAGCCTGGACAGTCGGCCTTTACTGCTG
CATCTGAAAGTTCTTCTGTATCGACACAAGGCGAAATTGGTCGAAACCGTGGGGTTGAAGACTCAGCTTC
AGCAATGAATATGAGCGTCACTGATCAGGCCGCTTACAACTCAGCTATCGGTAAATCCACTGAAACCGGT
GAGGCCAAAGGGACTGAGCAAGCCTTCGGCTCGCTGGATAACATTGGCAATAAAACCGCATTTAATACCG
CTGTTAGTAAAGCCACTCAAGCTGGTGAATCTAAAGGGGTTATGGATGCAGCGGGTAATAACCTCAGCAA
TGTTGAATCTCGTCAGAGTGAAATTAGCAGCGTAAGAAGCGCTGAGAACATCGGTGAAGCCAGAGGTACA
AAAGATGCCTTTGGTTCTCTCAGTGGCATAGAGAGCAGCACACAGTTCAATACGGGTGAATCTAAAGCTC
AGGGGCTGGTTGATAATCAGCGCCAGCGTGATCAAGTCGAAACAATCAGTGCTGAAACAGGCAGTACAAT
ACCTGAAGCTCGTAGACACTTATCTGACGCTAACAGTGCTCCCGTTCAAGCTAGCTTGGCAGCTAACGGC
TATGACGGTCAGAAAGTAATCGACACGGCAACCTATGATGCTCAACAGCATGTGGCTTCACAGCATGGCG
AACGAGCAGCATTTGCCGAGCAGGGAGTTGTACCGCAAGAAGTTGCCGGATACACCGGCTACAAAGAAGG
CTTTAATACAGTGGCCTCCAATGAAACAAACCGCAAATTGTCTGACGCTATGGACGGTGAAGATAATCGA
GCAAGGGCTGAAGCCGGTGCTAACCATCATATGGCGCTTAACAAAGATAATGCTGAAGGGCTGCATAAGG
CTGGCATTATTAATGAAGAACAGCTCAATAGCTTAGACAGTGGCGGTCGTGCCGACTTCTCAATGATTTC
CGGTAAAGATGGCAATGTGACTGGAACATCCGCTGTTCATTCAGGACAAAGTACCAGTGCAGACAGTAGC
GCAACTTACAATAGCCAGAGCAGCATTAACCAAGGGCTTGATGCCGGTTCTGCCGTGAGCCAACGCAACC
AGCTGTCTACAAAAGAGGGTGTTCGTAATCTTATCGATCAAAGTGAACGTAATTCACCAAAATCAGGACA
GTTTATTAATGATTTGGCGCACTTCAGTGCTGAATCCTTAACGCCATTTACCAACTCAACCAAAATGGAT
AGCGTACATCAATCGGCAAGTACATCACTTACCGGTGGAACACCTGGCTCGGGTATTCTTGGATTCGGGG
CCAGTGCGACAACAACAGTAGAAGGATCTACAACCGATCAAGACCATTACAATCAAAGAGCCGGACAATT
TAAACACCAGCTCGAATCGATGTCTCAAGCAGGTATGGCAGAAGCTGATAAGCAAGGCTTGCACGGGGCC
GATAAAGATAATTACGTCAAAGATTATGTTGCCGACAACTATTCTCAATATTACCAACAGGAGTATAGAA
ATTCAGCGAATGAGACGATGAAGGAGTCTTCAGGATCAGCCCAAGCTGGGCGAGATAAAGACTATAATCA
GCAAAACGGATTATATTCACAGCCAGGCACCTACACCGCTCCTGATAATTATCGTTCATTATCAGCACAA
GAAAATGCACATATACGTTCACAACAGGGTGAAGGCCAATTAGCCAGTGATAAATTTGAATATGGTCAAG
TACCACAACAAACAACCAGCGTAAGCTCCAGCGGTGAACCGGAAACCATAGTAAGAGAAGTTAAAGTACA
AGCCCCGCCAAGAGTGAGCGCCGATACATCGAGTTCTGAGATTCAACCCTCACAGGGAATGGCTCAGCAA
AGCAGCACATCCCCTTCAACTATGCCACCAGTTAAAGGAGAAACCAGGTCAAAATCAGATATGCCCCCCG
TAGGTAAAAAGTAA
 Primer design