SecReT4
Protein ID: 169544308
T4SS name [ID]Tra_F [806]
Gene symboltraH
Locus tagpYE854_p135
StrainYersinia enterocolitica plasmid pYE854 (NC_010377)
Repliconplasmid pYE854 [GenBank: NC_010377] [Browse all T4SS(s) in this replicon]
Location [Strand]58488..59876 [-]
Productputative pilus assembly protein
Component typeTraH_F
UniProt IDB0RKZ1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 2e-69, Aligned region: 27..368
Protein Sequence: 462 a.a.     [Download]
>gi|169544308|ref|YP_001693083.1| putative pilus assembly protein [Yersinia enterocolitica]
MINLKKIVILTLTSLYITAANADNWADKWFDNAVYDTPSSFESQKRGYYTMGGFSARNNSSTDYPITISP
PKLSVGCGGIDAFLGGFSFLDPDYLVEKAQRAMQAAPYVAFDMALKTMCKECADTLGKIEQITNFLNGIQ
LNECALAKPIATAAITQDAEALKGLWTEMTGTKSLDEASDRLWTESTSKIKANDNKPTQDLKSMIEGCPA
EFKDLMQHGSIVERAAQKVGLGNYADTIRGYLGDVWIESKTADRIPVAVSIPSCPQNQKYSLDDMLTGRS
FVKTINKQCVPSSSKPVRDIVFAKMQKVLNKMKAGQELGTDEVKFINSTNLPVYSILKQAITSKQDDVML
NVLAELVGLNYSYYIFSDLYRNTQSAFDAVNEMMSSPLSDPNNAKKPCRMDLFAPALSKFGDLIQQARDS
SVKVEATYNSRLQSYMLNSGFIETFREQEMRDQRHRAGELAK
 
Nucleotide Sequence: 1389 bp     [Download]
>gi|169544164|ref|NC_010377.1|:c59876-58488 Yersinia enterocolitica plasmid pYE854, complete sequence
ATGATAAATCTTAAGAAAATAGTCATTCTTACTCTAACCAGTCTATATATCACCGCTGCAAATGCTGATA
ATTGGGCTGATAAATGGTTTGATAATGCAGTCTATGACACGCCTAGCTCATTTGAGTCACAAAAGCGTGG
CTATTACACTATGGGGGGCTTCTCTGCCCGTAACAATTCATCTACTGATTACCCTATAACAATCTCCCCG
CCCAAACTTAGCGTTGGTTGTGGTGGTATAGATGCATTTTTAGGGGGGTTCTCATTCCTCGATCCTGATT
ATCTGGTAGAAAAAGCACAACGTGCCATGCAAGCAGCTCCGTATGTTGCTTTTGATATGGCCCTTAAGAC
AATGTGCAAAGAGTGTGCAGATACACTCGGCAAAATTGAGCAGATCACTAACTTCTTAAACGGTATCCAG
CTGAATGAATGTGCTCTGGCAAAACCTATTGCGACCGCTGCAATTACGCAAGATGCCGAAGCCTTAAAAG
GTCTTTGGACTGAAATGACCGGCACAAAAAGTTTAGATGAAGCTAGTGATAGGCTTTGGACGGAATCGAC
ATCAAAAATTAAGGCCAATGACAATAAACCAACTCAAGATCTGAAGAGCATGATTGAAGGTTGCCCAGCT
GAGTTCAAAGACCTAATGCAACATGGCTCTATCGTCGAACGGGCAGCGCAGAAAGTAGGACTTGGCAACT
ACGCTGATACTATCCGTGGGTATCTCGGGGACGTATGGATTGAGTCTAAGACCGCTGATCGTATTCCGGT
AGCCGTCTCTATACCAAGTTGCCCTCAAAACCAGAAGTACAGCCTCGATGATATGTTAACGGGGCGCTCT
TTTGTCAAAACGATTAATAAACAGTGTGTTCCCTCCAGCAGTAAGCCTGTCAGAGATATTGTTTTCGCGA
AAATGCAAAAAGTGCTGAATAAAATGAAAGCAGGGCAAGAGCTGGGGACGGATGAAGTTAAGTTTATTAA
CTCCACTAATCTCCCCGTTTATTCAATTCTTAAACAAGCGATTACCAGTAAACAAGATGATGTCATGTTG
AATGTCTTGGCTGAATTAGTTGGCTTGAATTACTCGTATTATATTTTCTCTGACTTATATCGGAATACCC
AAAGTGCTTTTGACGCTGTTAACGAAATGATGTCATCCCCATTATCTGACCCGAATAATGCGAAGAAGCC
ATGCAGGATGGATTTATTCGCACCGGCGCTATCAAAGTTTGGCGATCTCATACAACAGGCCCGAGATAGT
AGCGTCAAAGTTGAAGCGACCTATAACAGCCGGTTACAAAGCTACATGCTGAATTCCGGCTTTATCGAAA
CATTTCGTGAGCAAGAAATGCGAGACCAGCGTCACCGTGCAGGGGAGCTAGCGAAATGA
 Primer design