SecReT4
Protein ID: 169544310
T4SS name [ID]Tra_F [806]
Gene symbol-
Locus tagpYE854_p137
StrainYersinia enterocolitica plasmid pYE854 (NC_010377)
Repliconplasmid pYE854 [GenBank: NC_010377] [Browse all T4SS(s) in this replicon]
Location [Strand]59886..60749 [-]
ProductTraF precursor
Component typeTraF_F
UniProt IDB0RKU0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 5.1e-32, Aligned region: 48..255
DUF836 [PF05768], Evalue: 1.7e-05, Aligned region: 173..228
Protein Sequence: 287 a.a.     [Download]
>gi|169544310|ref|YP_001693085.1| TraF precursor [Yersinia enterocolitica]
MINSLITSVFSLFVSFGSSGAAHASMPNQLSLPESLQPSSLIKTPKRGLFWYDVPTKTETKSDEKYPRPA
IPSAEALFQMHPKELKALLDDTLDYAVFKLSPEATMDYYKVLDVARRKSSAFTNLTGFVMLDKPELNAAQ
DYPITNPGNAEKKRRTDNDVTKKLQAAREEYALLFFTQPACGFCVQQSQILENFQRESGWIIKEVDIIKE
PQSRTKFNIDRTPVTVLIRKNGDSKQWMPVSVGVDSLSNLRSNIYRITRLFGGEIKPQQFYTNEQQQGGF
FDPLKRQ
 
Nucleotide Sequence: 864 bp     [Download]
>gi|169544164|ref|NC_010377.1|:c60749-59886 Yersinia enterocolitica plasmid pYE854, complete sequence
ATGATTAACTCACTTATCACTTCAGTTTTCAGCCTATTTGTTAGCTTTGGCTCTTCTGGCGCTGCGCATG
CTTCTATGCCTAATCAACTTTCATTACCTGAGTCTCTTCAACCATCATCGCTGATTAAAACACCAAAACG
TGGTCTTTTTTGGTATGACGTACCGACAAAAACAGAAACAAAATCTGATGAGAAATATCCACGCCCAGCC
ATTCCCTCAGCTGAAGCGCTATTTCAAATGCATCCTAAAGAACTGAAAGCCCTACTGGATGACACCTTAG
ATTATGCCGTCTTCAAACTGTCCCCTGAAGCCACAATGGACTATTACAAAGTCCTCGATGTTGCTCGTCG
CAAATCATCTGCTTTTACCAACCTTACGGGTTTCGTGATGCTGGATAAGCCAGAATTGAACGCCGCTCAA
GACTACCCCATTACCAACCCTGGTAACGCAGAGAAAAAGCGTCGTACTGACAATGATGTGACCAAAAAAT
TGCAAGCTGCCCGTGAAGAATACGCGTTGTTGTTCTTCACTCAACCTGCATGTGGTTTCTGTGTCCAGCA
ATCTCAAATACTTGAAAACTTCCAACGGGAATCGGGCTGGATTATCAAAGAAGTCGATATCATAAAAGAA
CCTCAATCGCGCACAAAATTCAATATTGACCGGACGCCGGTGACTGTATTGATTCGCAAAAACGGCGACT
CAAAACAATGGATGCCGGTTTCTGTTGGTGTGGATTCTCTTAGCAATCTACGGTCGAACATTTACCGTAT
CACTCGTCTATTTGGCGGTGAAATTAAGCCGCAGCAATTCTATACAAACGAGCAGCAGCAAGGCGGCTTC
TTTGACCCGTTAAAGCGTCAATAG
 Primer design