SecReT4
Protein ID: 169544314
T4SS name [ID]Tra_F [806]
Gene symboltrbC
Locus tagpYE854_p141
StrainYersinia enterocolitica plasmid pYE854 (NC_010377)
Repliconplasmid pYE854 [GenBank: NC_010377] [Browse all T4SS(s) in this replicon]
Location [Strand]61653..62372 [-]
Productsex pilus assembly and mating pair formation protein TrbC
Component typeTrbC_F
UniProt IDB0RKU4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 1.8e-26, Aligned region: 98..221
Protein Sequence: 239 a.a.     [Download]
>gi|169544314|ref|YP_001693089.1| sex pilus assembly and mating pair formation protein TrbC [Yersinia enterocolitica]
MKKLLITISLALTANLVHAQNIAISPEMMNAAQSAVDHRVNNKEMNSFAENIASYSKSSEFKQQQQDLQQ
QVFKTAGLDPDKQQHEERPELVKDQLVLFVSSSMPIHTLRNYARDLSKVGGVMVLRGAVGGISRIADTMK
LSREILAVNQTCDTTSCKMWSTQVLIDPVLFKQYDIKVVPALIFQPDMNINSYCDGLELMKKAETIIYGD
ASIAKMLEAMNRITPNKKYESLIKVIRGL
 
Nucleotide Sequence: 720 bp     [Download]
>gi|169544164|ref|NC_010377.1|:c62372-61653 Yersinia enterocolitica plasmid pYE854, complete sequence
ATGAAAAAACTATTGATCACTATATCGTTAGCGCTAACGGCAAATCTTGTGCATGCACAAAACATTGCTA
TCTCACCTGAAATGATGAATGCGGCACAATCCGCAGTGGATCATCGGGTTAATAATAAAGAAATGAACAG
TTTTGCCGAAAACATAGCTAGCTATTCCAAATCATCAGAATTTAAGCAGCAGCAGCAAGACCTACAGCAG
CAGGTTTTCAAAACAGCCGGTTTAGACCCTGATAAACAGCAACATGAAGAACGTCCTGAATTGGTCAAAG
ACCAGCTGGTACTATTTGTATCCAGCAGCATGCCTATCCATACCCTACGAAACTATGCGCGGGATTTGTC
TAAAGTCGGGGGGGTTATGGTATTACGAGGCGCGGTTGGTGGAATTAGTCGTATTGCAGACACCATGAAG
CTGAGCCGCGAAATCCTGGCGGTTAACCAGACCTGCGATACAACATCATGCAAAATGTGGTCAACTCAAG
TTCTGATTGATCCGGTTCTATTTAAACAATATGACATTAAAGTTGTTCCTGCGCTGATCTTCCAGCCAGA
TATGAATATTAATAGTTATTGTGATGGTCTGGAATTAATGAAGAAAGCAGAGACTATTATTTATGGTGAT
GCCTCTATTGCTAAAATGCTAGAAGCCATGAATCGAATCACTCCGAATAAAAAATATGAATCACTTATCA
AAGTCATTCGGGGGCTATAA
 Primer design