SecReT4
Protein ID: 169544316
T4SS name [ID]Tra_F [806]
Gene symboltraU
Locus tagpYE854_p142
StrainYersinia enterocolitica plasmid pYE854 (NC_010377)
Repliconplasmid pYE854 [GenBank: NC_010377] [Browse all T4SS(s) in this replicon]
Location [Strand]62372..63955 [-]
ProductTraU family protein
Component typeTraU_F
UniProt IDB0RKU6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 5.8e-59, Aligned region: 233..525
Protein Sequence: 527 a.a.     [Download]
>gi|169544316|ref|YP_001693091.1| TraU family protein [Yersinia enterocolitica]
MKSSLSASAFFVAMLLSSHVEASQNVIGQLYSISEPDALEQIQERVANVDWQKELNKDREKWGAFKGVPL
PTTQEDKTRKVIPFYSAPFEVKDKDGRLLFPKGYTFNPLVHVRLPQRLIIVEKGQEDWLKSIATESDMII
YASGDVIEVSQRIGRNAFILDKNLQQRLDIKVVPSIIQQEGEHLIIQEFSKQHVENARDKALLDFNGKKL
AWSVVGSVMDFLVSPAHATCKSSFINPITDISWSCIFPMRIAGVQVVGGEENPSNSQSPVCVCKGAALPM
IGLKTSFWEPKRIIDTVSDPYCMMPLGTQLSKPVPGTLSGGYVETNTSKRVFQQAHYFIFPAWKILNMFY
DIPCLDDEGFDVAMMTEILPQWNNEALSLIINPEALLFANPVATIACSADAIAGTYGMPLNALFWCMGSW
GNVYPLSGSITSTDFVEANAGIAARSIFTMGRLGLLWNTSDDGCYRELAPIWKKDRFKLQLMRPTRANAC
LPIGREGLLWTGGKHDPLKDNFMWMMFEKKDCCIRAY
 
Nucleotide Sequence: 1584 bp     [Download]
>gi|169544164|ref|NC_010377.1|:c63955-62372 Yersinia enterocolitica plasmid pYE854, complete sequence
ATGAAATCATCACTCTCAGCATCGGCTTTTTTCGTGGCGATGCTGCTATCTTCACATGTTGAAGCCTCAC
AAAACGTTATCGGTCAACTTTATAGCATCAGTGAACCCGATGCTTTGGAACAAATTCAAGAGCGTGTTGC
TAACGTCGATTGGCAAAAAGAACTCAACAAAGATCGTGAAAAGTGGGGGGCATTCAAAGGGGTTCCACTA
CCAACCACTCAGGAAGATAAAACTCGTAAGGTGATACCGTTCTATTCTGCACCTTTTGAAGTGAAAGATA
AGGATGGACGTTTACTATTTCCGAAAGGCTACACTTTTAACCCACTGGTACATGTTCGACTCCCTCAACG
TTTAATCATTGTAGAGAAAGGACAAGAAGACTGGCTTAAGTCAATAGCAACTGAATCTGACATGATCATT
TATGCAAGTGGTGACGTTATTGAAGTTAGCCAGCGTATCGGTAGAAATGCCTTCATCCTCGATAAGAACT
TACAACAACGCCTTGATATCAAAGTTGTCCCTTCCATCATTCAACAGGAAGGGGAACACTTAATCATTCA
AGAATTTTCTAAACAGCATGTTGAAAATGCTAGAGATAAGGCTCTGCTTGATTTTAATGGCAAAAAACTG
GCGTGGTCAGTAGTCGGTTCGGTAATGGATTTCTTAGTCTCTCCCGCACACGCAACCTGCAAATCATCAT
TTATAAACCCAATTACAGATATTAGCTGGAGCTGTATTTTCCCCATGCGGATAGCTGGAGTACAGGTTGT
TGGCGGTGAGGAAAACCCCTCGAATAGCCAAAGTCCTGTTTGTGTCTGTAAAGGGGCCGCACTCCCGATG
ATTGGCCTTAAAACTTCCTTTTGGGAACCTAAGCGCATAATCGATACGGTCAGTGACCCTTATTGTATGA
TGCCCTTGGGAACACAACTGAGTAAACCAGTACCAGGCACTCTTTCCGGTGGCTACGTCGAAACCAATAC
CAGTAAACGAGTATTTCAACAGGCACATTATTTTATTTTTCCTGCCTGGAAAATTTTGAATATGTTCTAC
GACATCCCTTGCCTGGATGACGAAGGTTTTGATGTCGCCATGATGACGGAGATCTTACCGCAGTGGAACA
ATGAAGCGCTCAGTCTGATTATTAACCCTGAAGCCCTGCTTTTTGCTAATCCGGTGGCAACAATTGCCTG
TTCTGCCGATGCAATCGCTGGCACTTATGGTATGCCCCTTAATGCATTGTTTTGGTGCATGGGGAGTTGG
GGAAACGTCTATCCTCTGTCTGGTTCTATCACTAGCACCGATTTCGTCGAAGCTAATGCTGGTATCGCTG
CTCGCTCAATTTTCACTATGGGCCGATTAGGTTTGTTGTGGAATACCTCAGATGATGGCTGTTATCGAGA
ACTGGCACCTATCTGGAAAAAAGACCGCTTTAAGTTACAGCTTATGAGGCCAACCCGCGCTAATGCATGC
CTTCCTATAGGACGTGAGGGGTTGTTATGGACTGGCGGCAAACATGACCCACTTAAAGATAACTTTATGT
GGATGATGTTTGAAAAGAAAGATTGTTGCATCAGGGCTTACTAA
 Primer design