SecReT4
Protein ID: 169544328
T4SS name [ID]Tra_F [806]
Gene symboltraN
Locus tagpYE854_p149
StrainYersinia enterocolitica plasmid pYE854 (NC_010377)
Repliconplasmid pYE854 [GenBank: NC_010377] [Browse all T4SS(s) in this replicon]
Location [Strand]65944..67995 [-]
Producttype IV conjugative transfer system protein TraN
Component typeTraN_F
UniProt IDB0RKZ8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 683 a.a.     [Download]
>gi|169544328|ref|YP_001693103.1| type IV conjugative transfer system protein TraN [Yersinia enterocolitica]
MRFRMSKLSIIIWAALLPCFFVHAQKQESISKASQDKVDSIANDINGVVKGKTNSATTINNSLLSPMNGQ
GQMSTFDGKQSFDGKAVCKGTSEFMKMLVQPGAGGDVTILNVMQDTNMDGKLDITMAPNWNVSAVCSNGF
MTCTDPNNTTTCTSWAWTADSKSYQLGRKRVALTDLGGCYCINNKCGSNLAWTNMGQILRNLGGGASQAL
AAVNPWYTLSDVKIDGVIASFVGGDAGSCNVGDSTGFFNSPDGSQLLTYQNNETKMKDDAANSTQNSDAY
KAIVNGSLNPNETSETRRCEVRRNVGIDEPTLDEIIKFDGGEGQVTQCGTDCLQLVLGRLGNDYWQGNCS
YYEVKSNFILKDPSRIKSATLINAVFDDWMQVWVGDKVAWNGPYGNWTDAGPVPGACELVTSWNVNPNMD
FAQYMKNPGPLQFKIRVEVSGAGEGYALLRVKTDMSCKLGAESISNTCTAYENDSTCKLVDEEIDGIKSF
IGGINTGLKPLSQTHKINGNFCSIEVKRDWFTKKRVYRCNTKNDYDTSKIIERKGYIDDNVKPDHYKDKM
FSENGKVTLGEGDLFWPKLPTVNECVNVCKTRKEKTTPDMSVSGQIDKNKKPGQKVYNYFYHECSSDNKC
SSDEGEEVVKACQCINEFAEAAAIMQTMRQAGQDMICSSGEIKNPNGTPVESN
 
Nucleotide Sequence: 2052 bp     [Download]
>gi|169544164|ref|NC_010377.1|:c67995-65944 Yersinia enterocolitica plasmid pYE854, complete sequence
ATGAGGTTCCGGATGAGTAAACTTTCAATAATCATATGGGCGGCATTGCTGCCCTGTTTTTTTGTGCATG
CACAAAAACAAGAGAGCATCAGTAAAGCCTCACAAGACAAAGTTGATTCAATCGCCAATGACATTAACGG
TGTCGTCAAAGGTAAAACCAACTCAGCTACAACGATTAATAACTCCTTATTGAGTCCAATGAACGGACAA
GGCCAAATGTCCACCTTCGATGGTAAACAGTCATTTGATGGTAAGGCCGTCTGTAAAGGTACGTCTGAGT
TTATGAAAATGCTGGTTCAACCAGGCGCTGGCGGTGACGTAACCATTCTGAATGTTATGCAAGATACCAA
TATGGACGGCAAGCTAGATATCACAATGGCCCCTAATTGGAACGTATCAGCGGTGTGTTCCAATGGTTTT
ATGACTTGTACCGACCCCAATAACACCACAACCTGTACTTCGTGGGCCTGGACAGCCGACAGTAAAAGCT
ACCAGTTAGGACGCAAACGAGTAGCCCTAACGGATCTTGGCGGGTGTTACTGCATCAATAATAAATGCGG
CAGTAATTTGGCATGGACGAACATGGGGCAAATCCTTCGTAACCTTGGCGGTGGGGCGTCTCAAGCCTTG
GCTGCTGTCAATCCTTGGTACACCCTTTCTGATGTCAAAATTGACGGTGTTATCGCGTCATTTGTTGGTG
GTGACGCGGGTTCATGCAATGTTGGCGACTCTACCGGCTTCTTTAACAGCCCCGATGGTTCCCAGCTCCT
GACATACCAGAATAACGAAACGAAAATGAAGGATGATGCTGCAAATTCGACTCAAAACTCTGATGCATAT
AAAGCCATCGTTAATGGCAGTTTAAACCCGAATGAAACCTCTGAAACCCGACGCTGTGAGGTACGCCGCA
ATGTTGGCATCGATGAGCCAACATTAGATGAAATCATCAAATTCGATGGGGGGGAAGGACAGGTAACTCA
ATGCGGAACTGATTGTCTTCAGTTGGTACTAGGGAGGCTTGGTAACGACTATTGGCAAGGTAACTGTAGC
TACTACGAGGTTAAGAGTAATTTTATCTTAAAAGATCCTTCCCGCATTAAATCGGCAACCTTAATCAATG
CTGTATTTGATGACTGGATGCAAGTTTGGGTAGGTGACAAGGTTGCATGGAATGGCCCTTACGGTAACTG
GACTGATGCTGGCCCCGTGCCTGGGGCATGTGAGCTAGTGACAAGTTGGAACGTAAATCCAAACATGGAT
TTTGCGCAGTATATGAAAAATCCTGGCCCTCTCCAGTTCAAAATCCGTGTTGAAGTTAGCGGGGCGGGGG
AAGGGTATGCATTGTTACGCGTTAAGACGGATATGAGCTGCAAATTAGGAGCCGAATCTATTTCTAATAC
TTGTACTGCCTATGAAAATGACTCGACCTGTAAGCTGGTAGATGAGGAAATTGACGGCATTAAATCATTT
ATCGGCGGTATAAACACCGGCCTTAAGCCGTTATCCCAAACACATAAGATAAACGGTAATTTTTGTAGCA
TTGAAGTTAAACGCGATTGGTTTACTAAAAAGAGAGTCTATCGTTGCAACACAAAGAATGACTACGATAC
ATCTAAAATTATTGAACGAAAAGGATATATAGATGACAACGTTAAACCAGATCACTATAAAGATAAAATG
TTTTCAGAAAATGGAAAGGTCACATTAGGAGAAGGTGATTTATTTTGGCCTAAATTACCTACAGTCAATG
AGTGCGTAAATGTCTGCAAGACAAGAAAGGAAAAAACCACACCTGATATGTCAGTTTCTGGTCAAATTGA
TAAAAATAAAAAGCCAGGTCAAAAAGTATATAACTACTTTTATCATGAATGTAGTTCAGATAATAAATGT
TCTTCTGATGAAGGTGAGGAAGTTGTTAAAGCTTGTCAGTGTATTAATGAATTTGCTGAAGCTGCCGCTA
TTATGCAAACAATGAGGCAAGCAGGACAAGACATGATATGTAGCTCAGGCGAAATAAAAAATCCTAATGG
CACACCTGTGGAATCCAATTGA
 Primer design