SecReT4
Protein ID: 169544330
T4SS name [ID]Tra_F [806]
Gene symboltraC
Locus tagpYE854_p150
StrainYersinia enterocolitica plasmid pYE854 (NC_010377)
Repliconplasmid pYE854 [GenBank: NC_010377] [Browse all T4SS(s) in this replicon]
Location [Strand]67997..70570 [-]
Producttype IV secretory pathway VirB4 component
Component typeTraC_F
UniProt IDB0RL05
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 2e-33, Aligned region: 469..746
TraC_F_IV [PF11130], Evalue: 9.8e-31, Aligned region: 30..234
DUF87 [PF01935], Evalue: 3.2e-06, Aligned region: 457..667
Protein Sequence: 857 a.a.     [Download]
>gi|169544330|ref|YP_001693105.1| type IV secretory pathway VirB4 component [Yersinia enterocolitica]
MLNVIGDLMDKYIFLRNHTTADNILDLNDRDSLSSFLPFVSYKEEIETESGEKIKSKAFFNIDNTIGWIW
ELTPLPFVGEDQLGKLHNIVKTHYPKGTVAQWILYPDHNIDDILDEYAACRVQGDPITDMNVRNTSQYLR
NGAENGIHPQMNGIPVRNFRVFYTIKCEEMIREDLLSSIEQIFDTAGMAPRRIGATELIRWMSEFFCGKK
FTGEYDPERPLAKQMMSNDPAYDRSFDNGGHHEALQDFSVTPNILGHRYGTCLFPNVIPQKDNNPLRTNE
LFGGYKGVIDDRGQIKYPFLYTLTIIYDELQTDIANKASQTMFQRVGAGLVFALKERINEFSQMQQTLAQ
GGDFAYFIPQLWVFGKTKKDVRAAVSEAKDLWGNHKFELMPETNMSKVMYLTALPFGFYNIDSNLKNMDR
FFYADYENIARFLPVQGDFRGGGKPVQTYIGRKGQIIGLDMFDKRVNSHNFYVVAETGGGKSFLLNDLLD
SYASCGAKIRITDLGASYKKLTHIRKGRYIDFALDKPMCMNPSDFIAKDAEDLEQNIAAAVLIYSSCAYS
FTGQTVTEVEANLLDQACHASHRKGNQESGVDDIIAYLRSGEWKKGQEISVAAAQEIENQAQRLAFLLNN
FGSNGQFKKFFVGKSEFSISQDEFVCVDLEKLKSQKQLFFPMIMQVMNAMTQDLYLSDRSQKSFILFEEI
ASMVKQQGNISMDGLASMVEEGYRRARKYLGAFGIVLQSPLDLLLLKGLGQVAQANAPFKYYLESKMYAE
AVSKGVLPGIKGGFPLTLLESVKNARPRYGEVFIDSPLGMGVARLCVDKWRYWINTSDGDDVAQYNTLIQ
RGFQPVDALRQLSGVTL
 
Nucleotide Sequence: 2574 bp     [Download]
>gi|169544164|ref|NC_010377.1|:c70570-67997 Yersinia enterocolitica plasmid pYE854, complete sequence
ATGCTAAATGTAATTGGCGATTTAATGGATAAGTATATATTCTTACGTAATCATACTACGGCAGATAATA
TCCTTGACTTAAATGATCGAGATTCTCTTTCAAGCTTTCTTCCATTTGTTTCTTACAAAGAAGAAATAGA
AACTGAATCAGGTGAGAAAATTAAGTCAAAAGCATTCTTTAATATCGATAACACAATAGGCTGGATTTGG
GAGTTAACCCCGTTGCCATTTGTCGGTGAAGATCAGCTTGGTAAGCTACACAATATTGTTAAAACACATT
ATCCCAAAGGCACTGTTGCGCAATGGATACTTTATCCTGACCATAATATAGACGACATACTTGATGAGTA
TGCCGCCTGCCGCGTTCAGGGTGATCCTATTACTGATATGAACGTTAGGAATACCAGCCAATATTTACGC
AATGGTGCTGAAAATGGCATCCATCCTCAGATGAATGGCATTCCTGTTCGTAATTTCCGTGTGTTCTATA
CAATTAAATGTGAAGAGATGATTAGGGAAGATTTGCTCTCTTCTATCGAGCAGATCTTTGACACCGCAGG
TATGGCCCCGCGTAGAATTGGGGCCACCGAACTTATCCGTTGGATGAGTGAGTTTTTCTGTGGGAAGAAA
TTTACCGGTGAATATGATCCTGAACGACCACTCGCTAAACAAATGATGTCTAACGACCCCGCTTACGACC
GTTCTTTTGATAACGGGGGACATCATGAAGCCTTACAAGATTTTTCAGTAACGCCTAATATCCTAGGTCA
CCGTTATGGTACATGCTTATTCCCCAACGTTATTCCACAGAAAGACAATAACCCGCTTCGTACCAATGAA
CTCTTTGGCGGGTACAAAGGAGTAATTGATGATCGGGGGCAAATTAAATACCCATTTCTTTACACACTCA
CCATTATCTACGACGAACTGCAAACCGACATTGCGAATAAAGCGTCTCAGACCATGTTTCAACGAGTCGG
TGCAGGGCTAGTATTTGCACTAAAGGAACGTATTAATGAATTCTCACAGATGCAGCAAACTCTTGCCCAA
GGCGGAGATTTTGCCTATTTCATCCCGCAACTTTGGGTTTTTGGTAAAACTAAAAAGGACGTGCGAGCCG
CCGTTTCTGAAGCTAAAGATTTATGGGGAAACCATAAGTTTGAATTAATGCCAGAAACTAATATGTCCAA
AGTGATGTACCTAACCGCACTACCTTTTGGTTTTTATAATATTGATAGCAATCTGAAAAACATGGATCGC
TTTTTCTATGCTGATTATGAAAACATTGCTCGTTTCTTACCGGTTCAGGGTGATTTTCGGGGGGGTGGTA
AGCCCGTACAAACCTATATTGGCAGAAAAGGTCAAATCATTGGCCTAGATATGTTTGATAAACGCGTCAA
TTCACATAATTTCTACGTAGTAGCTGAAACCGGTGGCGGTAAGTCATTTTTACTTAATGACCTACTTGAT
TCTTACGCATCGTGTGGGGCCAAAATACGCATAACCGATCTCGGAGCTTCTTATAAAAAATTAACCCATA
TAAGAAAAGGCCGATATATAGACTTCGCGCTAGATAAGCCGATGTGTATGAATCCTTCAGATTTCATCGC
TAAAGATGCAGAAGATCTTGAACAAAATATAGCTGCGGCGGTTCTCATTTATTCATCATGTGCTTATTCA
TTTACCGGTCAGACTGTAACAGAAGTTGAAGCAAACTTACTTGATCAGGCTTGCCATGCCAGCCATAGAA
AGGGCAATCAAGAAAGCGGCGTTGATGACATCATCGCTTACCTGAGAAGTGGGGAATGGAAAAAAGGACA
AGAAATTTCTGTCGCAGCTGCTCAAGAAATAGAAAACCAGGCCCAACGCTTAGCTTTTCTGTTAAATAAT
TTCGGCAGTAATGGACAATTTAAAAAATTCTTCGTCGGAAAGTCTGAATTTAGTATTTCTCAAGATGAAT
TTGTTTGTGTCGATTTAGAGAAGTTGAAAAGTCAGAAACAATTATTCTTCCCCATGATCATGCAAGTCAT
GAATGCCATGACCCAAGATTTATACCTTTCTGACCGCAGCCAGAAAAGCTTTATTCTGTTTGAAGAAATT
GCCTCAATGGTTAAACAACAAGGCAACATCTCTATGGATGGGTTGGCCTCAATGGTTGAAGAAGGTTATC
GCAGAGCACGTAAGTATCTTGGTGCATTTGGTATTGTACTTCAGTCACCGCTCGATCTATTACTACTCAA
AGGGTTAGGCCAAGTAGCGCAAGCCAACGCCCCGTTCAAATATTATCTTGAATCTAAAATGTACGCTGAA
GCTGTTTCAAAAGGCGTCCTACCAGGTATTAAAGGCGGCTTCCCTCTCACACTCCTAGAATCAGTCAAAA
ATGCTCGCCCTCGCTATGGTGAGGTCTTCATTGATAGTCCTCTTGGAATGGGCGTAGCGCGCCTCTGTGT
TGATAAATGGCGCTATTGGATTAATACCTCTGACGGGGATGACGTGGCCCAATACAACACTCTTATCCAG
CGTGGATTCCAACCTGTGGATGCTTTACGCCAGCTATCCGGCGTGACTCTATAA
 Primer design