SecReT4
Protein ID: 169544333
T4SS name [ID]Tra_F [806]
Gene symbol-
Locus tagpYE854_p152
StrainYersinia enterocolitica plasmid pYE854 (NC_010377)
Repliconplasmid pYE854 [GenBank: NC_010377] [Browse all T4SS(s) in this replicon]
Location [Strand]70570..71076 [-]
Producthypothetical protein
Component typeTraV_F
UniProt IDB0RL08
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 2.4e-08, Aligned region: 25..144
Protein Sequence: 168 a.a.     [Download]
>gi|169544333|ref|YP_001693108.1| hypothetical protein pYE854_p152 [Yersinia enterocolitica]
MKLIKIAIILPVLILSGCGILPYHNDFACKLEDGYGKCISSADAYDEAVTGINKGKEITDSGVKDDPKAS
AAKAATSATAANSSVAYDKYRDRVYQQLTQLIAQPQTPVVKPAKVVRTLIMSYSPSMDGSVAYMPRYVFS
MLEGSQFVLTGYQLQQDAQSPEFLMGAK
 
Nucleotide Sequence: 507 bp     [Download]
>gi|169544164|ref|NC_010377.1|:c71076-70570 Yersinia enterocolitica plasmid pYE854, complete sequence
ATGAAACTCATTAAGATCGCAATTATTCTTCCTGTATTGATTTTATCTGGATGCGGTATTCTTCCTTATC
ACAATGATTTCGCCTGTAAATTAGAAGATGGATATGGGAAATGTATTTCCTCAGCTGACGCATATGATGA
GGCGGTTACGGGTATTAATAAAGGCAAGGAAATCACAGACAGTGGAGTAAAGGATGACCCAAAGGCATCT
GCCGCTAAAGCGGCTACCAGTGCTACTGCCGCCAATAGCTCTGTGGCCTATGACAAATATCGTGACCGTG
TTTATCAGCAACTCACACAATTAATTGCGCAACCACAAACACCGGTAGTAAAGCCAGCTAAAGTGGTCAG
AACTTTAATTATGTCTTACTCCCCGAGCATGGACGGTTCTGTTGCCTATATGCCTCGCTATGTTTTCTCT
ATGCTTGAGGGTTCGCAGTTTGTTCTCACTGGCTATCAATTGCAACAAGACGCCCAATCTCCTGAGTTCT
TAATGGGGGCGAAATAA
 Primer design