SecReT4
Protein ID: 169544334
T4SS name [ID]Tra_F [806]
Gene symboltraB
Locus tagpYE854_p153
StrainYersinia enterocolitica plasmid pYE854 (NC_010377)
Repliconplasmid pYE854 [GenBank: NC_010377] [Browse all T4SS(s) in this replicon]
Location [Strand]71100..72350 [-]
ProductTraB pilus assembly family protein
Component typeTraB_F
UniProt IDB0RL09
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 3e-19, Aligned region: 213..405
Protein Sequence: 416 a.a.     [Download]
>gi|169544334|ref|YP_001693109.1| TraB pilus assembly family protein [Yersinia enterocolitica]
MMSNKNIVENNKTTLLDKSKSWYYSKSSADRKKIVKYGTIASFIIIIFGFYYASGKAETVNKPIPKTSVV
ADTAEDKLLKDDVVAQLQGDIKDSNAKITDDVAKKIQDMINKGEFKLAPTPPVNLAEANISPVKENNELG
STTGNPVEFSYPQPLSESSPVSSDNSTPVDGTTPPDAGPIWLGDIAIDNSAFTQPPAEVNTEKKNQIQLP
VGFMKAHLLVGVNALTGEFGAENPQTVMFRVQAPAQLPNFIKMNLSGCFSVANVTGNLSMERIIALPISM
HCITRDKRFIVEGSIKGFVSDRDGKRDMSARVVSRAGPLLASTIFAKSIEGFANVVGSQGVTQNVSALGS
VNTIKNEDLAKTAATQGLAGGLSEVGKYLLDLAKQTAPALETGSGKDVMLFIQETATLEIKEVRIK
 
Nucleotide Sequence: 1251 bp     [Download]
>gi|169544164|ref|NC_010377.1|:c72350-71100 Yersinia enterocolitica plasmid pYE854, complete sequence
ATGATGAGTAACAAAAATATAGTTGAAAACAATAAAACCACCCTTTTGGATAAGTCTAAGTCTTGGTATT
ACTCTAAGTCTTCAGCTGACAGAAAAAAAATCGTTAAGTATGGCACTATTGCCAGTTTCATAATTATTAT
CTTTGGTTTCTACTACGCTTCAGGTAAGGCCGAAACAGTAAACAAGCCAATACCTAAAACATCAGTTGTT
GCTGATACCGCCGAAGATAAGTTATTAAAAGATGATGTTGTCGCACAATTACAAGGCGATATAAAAGATA
GTAATGCAAAAATCACTGACGATGTGGCAAAAAAAATACAGGACATGATCAATAAGGGGGAGTTTAAACT
TGCTCCCACACCACCAGTAAACTTAGCTGAAGCAAATATTTCTCCTGTTAAAGAGAATAATGAACTGGGT
TCAACTACTGGAAATCCGGTTGAATTTTCATATCCTCAACCCTTAAGTGAGTCTTCACCGGTATCTTCAG
ACAATAGTACACCGGTAGATGGGACTACGCCGCCCGATGCTGGCCCTATTTGGCTAGGTGATATTGCGAT
AGATAACAGTGCATTTACCCAGCCTCCGGCAGAGGTAAATACCGAAAAAAAGAACCAGATCCAGTTGCCG
GTTGGATTTATGAAAGCCCACCTTTTAGTAGGCGTTAATGCGTTAACCGGCGAATTTGGCGCAGAAAATC
CCCAAACAGTAATGTTTAGGGTTCAAGCACCGGCGCAATTGCCTAACTTCATTAAAATGAATCTTTCTGG
TTGCTTCTCTGTTGCTAACGTCACCGGCAACCTATCGATGGAACGTATCATTGCACTTCCAATCAGCATG
CATTGTATAACCAGAGACAAGAGGTTTATCGTTGAAGGATCAATAAAAGGATTTGTCTCTGATCGTGATG
GTAAACGTGATATGTCCGCTCGTGTCGTTTCCCGTGCGGGGCCATTGCTTGCTTCTACTATATTTGCAAA
AAGCATTGAGGGTTTTGCTAACGTAGTTGGCTCACAAGGGGTTACCCAAAACGTCTCCGCTTTAGGCTCC
GTGAACACCATTAAAAATGAAGATCTCGCTAAGACAGCAGCAACTCAAGGTTTAGCCGGTGGCTTAAGTG
AAGTCGGGAAATATCTATTAGACCTAGCCAAACAAACAGCACCAGCCCTAGAAACAGGTTCGGGTAAAGA
TGTCATGTTGTTTATTCAAGAAACCGCAACGCTTGAAATTAAAGAAGTTCGGATTAAATAA
 Primer design