SecReT4
Protein ID: 169544337
T4SS name [ID]Tra_F [806]
Gene symbol-
Locus tagpYE854_p156
StrainYersinia enterocolitica plasmid pYE854 (NC_010377)
Repliconplasmid pYE854 [GenBank: NC_010377] [Browse all T4SS(s) in this replicon]
Location [Strand]72347..73135 [-]
Producthypothetical protein
Component typeTraK_F
UniProt IDB0RL12
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 4.4e-23, Aligned region: 1..256
Protein Sequence: 262 a.a.     [Download]
>gi|169544337|ref|YP_001693112.1| hypothetical protein pYE854_p156 [Yersinia enterocolitica]
MNKLLLICALSLTSAVATAKVNNISTQRVLPEVSTTVTLSNRDVNRIVCESGEAVKPVFSKEKPMKVEIG
ADRKTFFVKFLFLQSAGGNQYYSEPTELYLTCGNATFELIINPQHEAARKVLLGSGTANTIKENQKLFSA
LSLEETATQLSISVMKDANDSGLGLPPTFEQQAINGSWEKASADRRGVAVPIELKKDREVNVEGTGLKAT
QFTIRALRNVQLSEMMFLNTRYGKNIFAITLESLSLSSGQMTSLVIIEREGL
 
Nucleotide Sequence: 789 bp     [Download]
>gi|169544164|ref|NC_010377.1|:c73135-72347 Yersinia enterocolitica plasmid pYE854, complete sequence
ATGAATAAACTACTCCTAATTTGTGCTCTCAGTCTTACCTCTGCTGTGGCGACGGCAAAAGTAAATAACA
TCAGTACCCAACGGGTTCTTCCTGAAGTCTCGACCACTGTTACATTAAGCAACCGTGATGTTAATCGCAT
TGTTTGTGAATCTGGCGAAGCTGTTAAGCCCGTTTTTAGTAAAGAAAAACCCATGAAAGTAGAAATTGGT
GCTGACAGAAAAACCTTCTTTGTTAAGTTCCTATTTCTACAGAGTGCGGGAGGAAACCAATATTACTCCG
AACCAACAGAATTATACTTAACCTGTGGTAACGCTACATTTGAACTGATTATTAACCCACAACATGAAGC
TGCCAGAAAGGTTTTATTGGGTTCAGGAACAGCCAATACTATTAAAGAGAATCAAAAGTTATTTTCAGCC
CTTTCTTTGGAAGAGACTGCAACGCAATTATCAATTAGCGTGATGAAAGATGCTAACGATTCTGGTCTTG
GACTTCCTCCAACCTTTGAACAGCAAGCAATAAATGGCAGTTGGGAAAAAGCATCGGCTGATCGTCGCGG
TGTAGCTGTTCCTATCGAATTAAAAAAAGACAGAGAAGTGAATGTTGAAGGAACAGGTTTAAAAGCGACT
CAATTCACCATTCGAGCCTTACGTAATGTTCAATTATCAGAAATGATGTTTTTAAATACTCGCTACGGAA
AAAATATATTCGCCATAACATTAGAATCTTTGTCATTAAGTTCAGGGCAAATGACTTCGCTCGTTATTAT
TGAAAGGGAAGGTCTATGA
 Primer design