SecReT4
Protein ID: 169544340
T4SS name [ID]Tra_F [806]
Gene symbol-
Locus tagpYE854_p159
StrainYersinia enterocolitica plasmid pYE854 (NC_010377)
Repliconplasmid pYE854 [GenBank: NC_010377] [Browse all T4SS(s) in this replicon]
Location [Strand]73797..74069 [-]
Producthypothetical protein
Component typeTraL_F
UniProt IDB0RL17
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 90 a.a.     [Download]
>gi|169544340|ref|YP_001693115.1| hypothetical protein pYE854_p159 [Yersinia enterocolitica]
MDYNGRLYKYPHLPIQVFWFDRDEWLLLIASYIGSMQIGGISYFIFFTATTIAISIKRSHGRGYFRHFLY
KFGLVEYKLYPDSTAEKFDE
 
Nucleotide Sequence: 273 bp     [Download]
>gi|169544164|ref|NC_010377.1|:c74069-73797 Yersinia enterocolitica plasmid pYE854, complete sequence
ATGGATTATAATGGCAGATTATATAAATACCCCCACTTACCAATTCAGGTATTTTGGTTTGACCGTGATG
AGTGGTTGTTATTGATCGCATCATACATTGGTTCTATGCAAATTGGTGGTATTAGTTATTTTATTTTTTT
TACCGCCACAACCATAGCTATCTCTATTAAGCGTAGTCACGGTCGAGGATACTTTCGCCATTTCCTATAT
AAATTTGGATTAGTTGAATACAAATTATATCCAGACTCCACCGCTGAAAAATTTGACGAGTAA
 Primer design