SecReT4
Protein ID: 169546471
T4SS name [ID]Tra_F [97]
Gene symbol-
Locus tagpVM01_p085
StrainEscherichia coli plasmid pVM01 (NC_010409)
Repliconplasmid pVM01 [GenBank: NC_010409] [Browse all T4SS(s) in this replicon]
Location [Strand]93994..94740 [-]
Productconjugal transfer pilus acetylation protein TraX
Component typeTraX_F
UniProt IDB1P7Q8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 9.8e-53, Aligned region: 32..247
Protein Sequence: 248 a.a.     [Download]
>gi|169546471|ref|YP_001711934.1| conjugal transfer pilus acetylation protein TraX [Escherichia coli]
MTTDNTNTTRNDSLAARTDTWLQSLLVWSPGQRDIIKTVALVLMVLDHANRILHLDQSWMFLVGRGAFPL
FALVWGLNLSRHTHIRQEAINRLWGWAVIAQFAYYLAGFPWYEGNILFAFAVAAQVLTWCETRTWWRSAE
TMLLLAMWLPFSGTSYGIAGLLMLAVSHRLYRAEDRMERLALVACLLAVIPALNLATSDAAAVAGLVMTV
LTVGLVSCTGKSLPRFWPGDFFPTFYACHLTVLGVLAV
 
Nucleotide Sequence: 747 bp     [Download]
>gi|169546410|ref|NC_010409.1|:c94740-93994 Escherichia coli plasmid pVM01, complete sequence
ATGACAACGGATAACACGAACACAACACGTAATGATTCACTGGCTGCCCGGACCGATACCTGGTTGCAGT
CGTTGCTGGTCTGGTCACCCGGACAGCGGGATATCATCAAAACGGTGGCACTGGTGCTGATGGTTCTGGA
CCATGCAAACCGCATTCTGCATCTGGACCAGTCGTGGATGTTTCTGGTCGGGCGTGGGGCCTTTCCGCTG
TTTGCCCTGGTGTGGGGGCTGAATCTGTCCCGTCATACGCATATCCGGCAGGAGGCCATTAACCGGCTGT
GGGGATGGGCGGTGATTGCCCAGTTCGCATATTATCTGGCCGGCTTTCCTTGGTATGAGGGGAATATCCT
GTTTGCCTTTGCAGTTGCGGCACAGGTGCTGACATGGTGTGAAACGCGCACCTGGTGGCGTTCCGCAGAG
ACCATGTTGCTTCTGGCAATGTGGTTGCCTTTCTCCGGCACCAGTTACGGCATTGCCGGGCTGCTGATGC
TGGCAGTCAGCCACAGGCTGTACCGGGCGGAAGACAGAATGGAACGTCTGGCGCTGGTCGCCTGCCTGCT
GGCTGTTATTCCGGCGCTTAACCTTGCCACCAGTGATGCAGCGGCGGTGGCCGGCCTTGTGATGACGGTG
CTGACTGTTGGTCTGGTGTCCTGTACAGGGAAATCACTACCCCGTTTCTGGCCCGGGGATTTTTTCCCGA
CGTTCTATGCCTGTCATCTTACTGTGCTGGGCGTTCTGGCTGTGTGA
 Primer design