SecReT4
Protein ID: 169546472
T4SS name [ID]Tra_F [97]
Gene symbol-
Locus tagpVM01_p086
StrainEscherichia coli plasmid pVM01 (NC_010409)
Repliconplasmid pVM01 [GenBank: NC_010409] [Browse all T4SS(s) in this replicon]
Location [Strand]94760..100030 [-]
Productconjugal transfer nickase/helicase TraI
Component typeTraI_F
UniProt IDB1P7Q9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrwC [PF08751], Evalue: 3.9e-87, Aligned region: 7..287
TraI [PF07057], Evalue: 2.7e-59, Aligned region: 1434..1560
AAA_30 [PF13604], Evalue: 7.5e-43, Aligned region: 968..1156
UvrD_C_2 [PF13538], Evalue: 5.1e-06, Aligned region: 1341..1444
AAA_19 [PF13245], Evalue: 3.5e-05, Aligned region: 982..1047
Protein Sequence: 1756 a.a.     [Download]
>gi|169546472|ref|YP_001711935.1| conjugal transfer nickase/helicase TraI [Escherichia coli]
MMSIAQVRSAGSAGNYYTDKDNYYVLGSMGERWAGRGAEQLGLQGSVDKDVFTRLLEGRLPDGADLSRMQ
DGSNRHRPGYDLTFSAPKSVSMMAMLGGDKRLIDAHNQAVDFAVRQVEALASTRVMTDGQSETVLTGNLV
MALFNHDTSRDQEPQLHTHAVVANVTQHNGEWKTLSSDKVGKTGFIENVYANQIAFGRLYREKLKEQVEA
LGYETEVVGKHGMWEMPGVPVEAFSGRSQAIREAVGEDASLKSRDVAALDTRKSKQHVDPEVRMAEWMQT
LKETGFDIRAYRDAADQRAETRTQAPGAVSQEGPDVQQAVTQAIAGLSERKVQFTYTDVLARTVGILPPE
NGVIERARAGIDEAISREQLIPLDREKGLFTSGIHVLDELSVRALSRDIMKQNRVTVHPEKSVPRTAGYS
DAVSVLAQDRSSLAIVSGQGGAAGQRERVAELVMMAREQGREVQIIAADRRSQMNLKQDERLSGELITGR
RQLLEGMAFTPGSTVIVDQGEKLSLKETLTLLDGAARHNVQILITDSGQRTGTGSALMAMKDAGVNIYRW
QGGEQRPATIISEPDRNVRYARLAGDFAASVKAGEESVAQVSGVREQAILTQAIRSELKTQGVLGHPEVT
MTALSPVWLDSRSRYLRDMYRPGMVMEQWNPETRSYDRYVIDRVTAQSNSLTLRDAQGETQVVRISSLDS
SWSLFRPEKMPVADGERLRVTGKIPGLRVSGGDRLQVASVSEDAMTVVVPGRAEPASLPVSDSPFMALKL
ENGWVETPGHSVSDSAKVFASVTQMAMDNATLNGLARSGRDVRLYSSLDETRTAEKLARHPSFTVVSEQI
KTRAGETSLETAISHQKSALHTPAQQAIHLALPVVESKNLAFSQVDLLTEAKSFAAEGTSFTDLGGEINA
QIKRGDLLYVDVAKGYGTDLLVSRASYEAEKSILRHILEGKEAVTPLMERVPGELMEKLTSGQRAATRMI
LETSDRFTVVQGYAGVGKTTQFRAVMSAVNMLPESERPRVVGLGPTHRAVGEMRSAGVDAQTLASFLHDT
QMQQRSGETPDFSNTLFLLDESSMVGNTDMARAYALIAAGGGRAVASGDTDQLQAIAPGQPFRLQQTRSA
ADVVIMKEIVRQTPELREAVYSLINRDVERALSGLESVKPSQVPRLEGAWAPEHSVTEFSHSQEAKLAEA
QQKAMLKGEAFPDIPMTLYEAIVRDYTGRTPEAREQTLIVTHLNEDRRVLNSMIHDAREKAGELGKEQVM
VPVLNTANIRDGELRRLSTWETHRDALALVDNVYHRIAGISKDDGLITLQDAEGNTRLISPREAVAEGVT
LYTPDTIRVGTGDRMRFTKSDRERGYVANSVWTVTAVSGDSVTLSDGQQTRVIRPGQERAEQHIGLAYAI
TAHGAQGASETFAIALEGTEGNRKQMAGFESAYVALSRMKQHVQVYTDNRQGWTDAINNAVQKGTAHDVL
EPKSDREVMNAERLFSTARELRDVVAGRAVLRQAGLAGGDSPARFIAPGRKYPQPYVALPAFDRNGKSAG
IWLNPLTTDDGNGLRGFSGEGRVKGSGDAQFVALQGSRNGESLLADNMQDGVRIARDNPDSGVVVRIAGE
GRPWNPRTITGGRVWGDIPDNSVQPGAGNGEPVTAEVLAQRQAEEAIRRETERRADEIVRKMAENKPDLP
DGKTEQAVRDIAGLERDRSAISEREAALPESVLREPQRVREAVREVARENLLQERLQQMERDMVRDLQKE
KTLGGD
 
Nucleotide Sequence: 5271 bp     [Download]
>gi|169546410|ref|NC_010409.1|:c100030-94760 Escherichia coli plasmid pVM01, complete sequence
ATGATGAGTATCGCGCAGGTCAGATCGGCCGGAAGTGCCGGTAACTATTATACCGACAAGGATAATTACT
ATGTACTGGGCAGCATGGGAGAACGCTGGGCCGGCAGGGGGGCTGAACAGCTGGGACTGCAGGGCAGTGT
CGATAAGGATGTTTTTACCCGTCTTCTGGAGGGAAGGCTGCCGGACGGAGCGGATCTAAGCCGCATGCAG
GATGGCAGTAACAGGCATCGTCCCGGCTACGACCTGACCTTCTCCGCTCCCAAAAGTGTCTCCATGATGG
CCATGTTAGGTGGCGATAAGCGCCTGATTGATGCACATAACCAGGCCGTGGACTTTGCTGTTCGTCAGGT
GGAGGCGCTGGCCTCCACACGGGTGATGACGGACGGACAGTCAGAAACGGTACTGACCGGTAATCTGGTG
ATGGCACTGTTTAACCACGACACCAGTCGCGATCAGGAACCACAGTTACACACGCATGCGGTGGTGGCTA
ATGTCACGCAGCATAACGGTGAGTGGAAGACACTGAGCAGTGACAAAGTGGGGAAAACGGGGTTCATTGA
GAATGTGTACGCTAATCAGATTGCCTTTGGCAGGCTCTACCGGGAAAAACTGAAAGAGCAGGTTGAGGCG
CTGGGCTATGAAACCGAAGTGGTGGGTAAGCACGGTATGTGGGAGATGCCGGGCGTACCGGTGGAGGCCT
TTTCCGGACGCTCACAGGCAATCCGGGAGGCCGTCGGGGAAGATGCCTCGCTGAAATCCCGGGATGTGGC
GGCACTGGATACGCGAAAATCCAAACAGCACGTCGATCCTGAAGTCAGAATGGCTGAATGGATGCAGACG
CTGAAGGAAACCGGGTTCGACATCCGGGCATATCGTGACGCGGCGGATCAGCGTGCGGAGACCCGCACGC
AGGCGCCCGGGGCTGTTTCACAGGAGGGGCCGGATGTGCAGCAGGCGGTGACACAGGCCATTGCCGGATT
AAGTGAACGAAAAGTGCAGTTTACGTACACGGACGTGCTGGCCAGAACGGTCGGCATACTGCCGCCGGAA
AATGGTGTGATTGAACGGGCACGCGCCGGTATCGATGAGGCCATCAGCCGTGAGCAGCTTATCCCCCTCG
ATCGTGAGAAGGGGCTGTTCACGTCCGGGATTCATGTGCTCGATGAGCTGTCAGTCCGGGCACTCAGTCG
TGACATCATGAAACAGAACCGGGTGACCGTACATCCGGAGAAAAGTGTCCCCCGGACGGCCGGTTACAGC
GATGCCGTCAGTGTTCTGGCACAGGATCGCTCGTCGCTGGCCATTGTGTCCGGGCAGGGCGGTGCAGCCG
GGCAGCGTGAGCGGGTGGCGGAGCTGGTAATGATGGCCCGGGAGCAGGGGCGGGAGGTGCAGATTATCGC
TGCTGACCGTCGCTCACAGATGAACCTGAAGCAGGATGAACGGCTGTCCGGTGAACTGATAACCGGGCGT
CGTCAGTTGCTGGAAGGCATGGCCTTCACACCAGGCAGTACAGTTATTGTCGACCAGGGTGAAAAACTCT
CCCTGAAAGAGACGTTAACCCTGCTGGACGGTGCCGCACGTCATAACGTACAGATCCTGATAACCGACAG
CGGGCAGCGAACCGGTACAGGCAGTGCGCTGATGGCCATGAAGGATGCCGGGGTGAACATATATCGCTGG
CAGGGCGGAGAGCAACGACCGGCAACCATCATCAGTGAACCAGACCGTAATGTCCGCTATGCCCGGCTGG
CTGGGGACTTTGCGGCCAGCGTGAAAGCCGGAGAAGAGAGCGTGGCACAGGTCAGCGGGGTACGGGAACA
GGCCATACTGACACAGGCCATTCGCAGTGAGCTGAAAACACAGGGCGTGCTCGGACACCCGGAGGTAACC
ATGACCGCCCTGTCACCGGTCTGGCTGGACAGCCGGAGTCGTTATCTGCGGGATATGTACCGCCCGGGAA
TGGTGATGGAGCAGTGGAACCCGGAGACACGCAGTTATGACCGCTATGTTATCGACCGGGTGACGGCGCA
GAGTAACAGCCTGACCCTGCGGGATGCGCAGGGTGAAACGCAGGTGGTGCGTATTTCCTCCCTGGACAGC
AGCTGGTCGCTGTTCCGGCCGGAAAAAATGCCGGTGGCAGACGGCGAGCGACTGAGGGTGACAGGGAAAA
TTCCCGGACTCCGCGTCTCCGGCGGTGACCGCCTGCAGGTGGCATCCGTCAGTGAAGATGCGATGACGGT
TGTTGTGCCGGGGCGGGCTGAACCGGCCTCCCTGCCTGTGAGCGATTCACCATTCATGGCACTGAAGCTG
GAGAACGGCTGGGTGGAAACGCCCGGGCATTCCGTCAGCGACAGTGCGAAGGTTTTTGCCTCCGTCACAC
AGATGGCAATGGACAACGCCACCCTGAACGGTCTGGCCCGCAGTGGTCGTGATGTCCGGCTGTATTCCTC
ACTGGATGAAACCCGTACTGCGGAAAAACTTGCCCGCCATCCGTCCTTTACGGTGGTTTCTGAGCAGATA
AAGACGCGGGCCGGTGAGACATCGCTGGAAACTGCTATCAGTCATCAGAAGTCCGCACTTCACACGCCGG
CACAGCAGGCCATTCATCTGGCCCTTCCGGTGGTGGAAAGTAAAAACCTGGCCTTCAGCCAGGTGGACCT
GCTGACAGAGGCGAAGTCGTTTGCTGCAGAAGGAACCAGTTTTACTGACCTGGGAGGGGAAATCAATGCG
CAGATAAAACGCGGTGATTTACTGTATGTGGATGTGGCAAAAGGCTATGGCACAGACCTGCTGGTTTCCC
GTGCGTCGTATGAGGCTGAAAAAAGCATTCTTCGCCATATTCTCGAAGGTAAGGAGGCGGTCACGCCGCT
GATGGAGAGAGTACCTGGCGAACTCATGGAGAAACTGACATCAGGACAGCGCGCCGCCACCCGCATGATA
CTGGAAACGTCCGACCGTTTCACGGTGGTGCAGGGGTATGCCGGTGTGGGTAAGACCACACAGTTCCGGG
CGGTGATGTCAGCCGTGAACATGCTGCCGGAGAGTGAGCGTCCCCGTGTCGTTGGGCTGGGCCCCACGCA
CCGTGCGGTCGGGGAGATGCGCAGCGCCGGCGTGGATGCACAGACACTGGCGTCCTTTCTGCATGACACG
CAGATGCAGCAGCGCAGCGGAGAAACGCCGGATTTCAGCAACACGCTGTTCCTGCTCGATGAGAGCTCAA
TGGTGGGCAATACCGACATGGCACGGGCATACGCCCTGATTGCGGCCGGTGGCGGTCGTGCCGTGGCCAG
CGGTGACACGGACCAGCTGCAGGCCATCGCGCCCGGTCAGCCTTTCCGTCTCCAGCAGACGCGCAGTGCT
GCCGATGTGGTCATCATGAAGGAGATTGTGCGTCAGACGCCGGAACTGCGGGAGGCGGTATACAGCCTGA
TTAACCGGGATGTGGAAAGGGCACTGTCCGGGCTTGAGAGCGTGAAACCGTCTCAGGTGCCACGTCTGGA
GGGCGCATGGGCACCGGAGCACTCCGTGACGGAGTTCAGTCACAGCCAGGAAGCGAAACTGGCAGAAGCG
CAGCAGAAGGCGATGCTGAAAGGCGAGGCTTTCCCGGATATCCCCATGACACTGTATGAAGCCATTGTCC
GCGACTATACCGGCAGGACACCGGAAGCACGGGAGCAGACGCTGATTGTCACACACCTGAATGAGGACCG
GCGCGTACTGAACAGTATGATTCATGATGCACGGGAAAAGGCCGGTGAGCTGGGAAAAGAGCAGGTCATG
GTGCCTGTCCTGAACACAGCGAATATACGCGACGGGGAGTTGCGTCGTCTCTCCACCTGGGAGACACATC
GGGACGCACTTGCCCTGGTGGATAATGTGTATCACCGGATTGCCGGTATCAGCAAGGATGACGGGCTGAT
AACCCTGCAGGATGCGGAAGGTAACACGCGGCTGATTTCGCCCCGGGAGGCGGTGGCTGAAGGCGTCACA
CTGTACACTCCGGACACCATCCGGGTGGGAACCGGTGACCGGATGCGCTTCACGAAGAGTGACCGGGAGC
GCGGTTATGTGGCCAACAGCGTCTGGACGGTGACAGCGGTTTCCGGTGACAGTGTCACGCTGTCGGACGG
ACAGCAGACCCGTGTGATTCGCCCCGGTCAGGAGCGGGCAGAGCAACATATTGGCCTGGCCTATGCCATC
ACCGCCCACGGTGCGCAGGGGGCAAGTGAAACCTTTGCCATTGCGCTTGAAGGCACGGAAGGTAACCGGA
AACAGATGGCCGGCTTTGAGTCAGCCTACGTGGCCCTGTCGCGTATGAAGCAGCATGTGCAGGTGTATAC
CGATAACCGTCAGGGCTGGACGGATGCCATTAACAATGCCGTACAGAAAGGAACTGCCCACGATGTGCTA
GAGCCGAAATCGGACCGGGAGGTCATGAATGCAGAGCGGCTGTTCAGTACGGCGCGGGAGCTGCGGGACG
TGGTGGCCGGCCGTGCCGTTCTCCGTCAGGCAGGGCTGGCCGGGGGAGACAGTCCTGCACGGTTTATTGC
ACCCGGGCGCAAATATCCGCAGCCGTATGTGGCACTGCCGGCTTTTGACCGTAACGGCAAGTCAGCTGGT
ATCTGGCTGAACCCGCTGACCACGGATGACGGAAACGGGCTGCGGGGCTTCAGTGGTGAAGGCCGGGTGA
AAGGCAGCGGGGATGCGCAGTTCGTGGCCCTGCAGGGCAGCCGTAACGGAGAGAGCCTGCTGGCTGATAA
TATGCAGGATGGTGTCCGGATTGCCCGTGATAATCCTGACAGCGGTGTGGTGGTAAGAATCGCCGGTGAA
GGTCGTCCGTGGAATCCCAGAACCATCACCGGTGGTCGCGTGTGGGGGGATATCCCGGACAACAGCGTTC
AGCCGGGAGCCGGAAATGGCGAACCGGTCACGGCAGAGGTACTGGCACAGCGGCAGGCTGAAGAGGCCAT
CCGCCGTGAAACGGAACGCCGTGCGGATGAAATTGTCCGTAAAATGGCAGAGAACAAACCTGACCTGCCG
GACGGCAAAACAGAGCAGGCTGTCAGGGATATTGCCGGGCTGGAGCGTGACCGGTCTGCCATATCTGAAC
GGGAAGCCGCGCTGCCGGAGAGTGTACTGCGTGAACCACAACGGGTGCGGGAAGCGGTCCGGGAGGTTGC
CCGGGAAAATCTGCTGCAGGAGCGACTGCAGCAGATGGAGCGGGATATGGTTCGTGACCTGCAGAAAGAG
AAAACCCTGGGCGGAGACTGA
 Primer design