SecReT4
Protein ID: 169546473
T4SS name [ID]Tra_F [97]
Gene symbol-
Locus tagpVM01_p087
StrainEscherichia coli plasmid pVM01 (NC_010409)
Repliconplasmid pVM01 [GenBank: NC_010409] [Browse all T4SS(s) in this replicon]
Location [Strand]100030..102183 [-]
Productconjugal transfer protein TraD
Component typeTraD_F
UniProt IDB1P7R0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 4.8e-148, Aligned region: 172..561
TraD_N [PF12615], Evalue: 5.2e-34, Aligned region: 31..129
TraG-D_C [PF12696], Evalue: 1e-18, Aligned region: 419..541
AAA_10 [PF12846], Evalue: 2.3e-10, Aligned region: 399..491
T4SS-DNA_transf [PF02534], Evalue: 8.7e-08, Aligned region: 382..478
Protein Sequence: 717 a.a.     [Download]
>gi|169546473|ref|YP_001711936.1| conjugal transfer protein TraD [Escherichia coli]
MSFNAKDMTQGGQIASMRIRMFSQIANIILYCLFIFFWILVGLVLWVKISWQTFVNGCIYWWCTTLEGMR
DLIRSQPVYEIQYYGKTFRMNAAQVLHDKYMIWCGEQLWSAFVLASVVALVICLITFFVVSWILGRQGKQ
QSENEITGGRQLTDNPKEVARMLKKDGKDSDIRIGDLPIIRDSEIQNFCLHGTVGAGKSEVIRRLANYAR
QRGDMVVIYDRSGEFVKSYYDPSIDKILNPLDARCAAWDLWKECLTQPDFDNTANTLIPMGTKEDPFWQG
SGRTIFAEAAYLMRNDPNRSYSKLVDTLLSIKIEKLRTFLRNSPAANLVEEKIKKTAISIRAVLTNYVKA
IRYLQGIEHNGEPFTIRDWMRGVREDQKNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WFFCDELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGEKAAATLFDVMNTRAFFRSPSHKIA
EFAAGEIGEKEHLKASEQYSYGADPVRDGVSTGKDMERQTLVSYSDIQSLPDLTCYVTLPGPYPAVKLSL
KYQTRPKVAPEFIPRDINPEMENRLSAVLAAREAEGREMASLFEPDVPEVVSGEDVTQAEQPQQPVSPAI
NDKKSDAGVNVSAGGIEQELKMKPEEEMEQQLPPGISESGEVVDMAVYEAWQREQNPDIQQKMQRREEVN
INVHRERGENVEPGDDF
 
Nucleotide Sequence: 2154 bp     [Download]
>gi|169546410|ref|NC_010409.1|:c102183-100030 Escherichia coli plasmid pVM01, complete sequence
ATGAGTTTTAACGCAAAGGATATGACCCAGGGCGGTCAGATTGCGTCCATGCGTATCCGCATGTTCAGTC
AGATCGCCAATATCATACTTTACTGCCTGTTTATTTTTTTCTGGATCCTAGTTGGTCTGGTTTTATGGGT
AAAAATAAGCTGGCAGACGTTTGTGAATGGCTGCATTTACTGGTGGTGCACCACGCTGGAAGGCATGCGG
GATTTAATCAGGTCCCAGCCGGTCTATGAGATCCAGTATTACGGCAAAACCTTCCGGATGAACGCGGCTC
AGGTACTGCATGATAAATATATGATCTGGTGCGGTGAGCAGTTATGGTCGGCATTCGTTCTGGCGTCTGT
CGTGGCCCTGGTTATCTGCCTGATCACCTTCTTTGTTGTCTCCTGGATTCTGGGGCGTCAGGGTAAACAA
CAGAGCGAAAATGAAATCACAGGTGGTCGTCAGCTGACTGACAATCCGAAAGAGGTGGCCAGGATGCTGA
AAAAAGATGGCAAGGATTCCGATATCCGGATTGGCGATCTGCCGATTATCCGGGATTCTGAAATCCAGAA
CTTCTGTCTGCACGGCACTGTCGGGGCCGGTAAGTCGGAGGTTATCCGTCGTCTGGCCAACTACGCCCGT
CAGCGTGGTGATATGGTGGTGATTTATGACCGTTCGGGGGAATTTGTTAAAAGTTACTATGATCCCTCCA
TCGATAAAATCCTGAATCCGCTGGATGCACGCTGTGCTGCCTGGGATTTGTGGAAGGAGTGCCTGACACA
GCCAGATTTTGATAATACCGCAAATACTCTGATCCCGATGGGGACAAAAGAGGACCCGTTCTGGCAGGGT
TCAGGACGTACCATTTTTGCGGAAGCGGCATACCTGATGCGTAATGACCCCAACCGCAGCTACAGCAAAC
TGGTGGACACACTGCTTTCCATCAAAATTGAAAAGCTGCGTACCTTCCTGCGTAATTCACCGGCGGCCAA
CCTGGTGGAAGAGAAAATCAAGAAAACGGCCATATCCATCCGTGCTGTGCTGACCAACTACGTGAAAGCC
ATCCGTTACCTGCAGGGGATTGAGCATAACGGTGAGCCCTTCACCATCCGTGACTGGATGCGTGGTGTCC
GGGAAGATCAGAAAAACGGCTGGCTGTTTATTTCGTCGAACGCCGACACCCATGCCTCCCTGAAGCCGGT
GATCTCCATGTGGCTGTCCATTGCTATTCGTGGTCTGCTGGCAATGGGAGAAAACCGTAACCGTCGTGTG
TGGTTTTTCTGTGACGAGTTACCCACGTTACACAAACTGCCGGACCTGGTGGAGATCCTGCCGGAAGCCC
GTAAGTTCGGTGGCTGTTATGTGTTTGGTATCCAGTCCTATGCCCAGCTGGAAGATATCTACGGTGAGAA
AGCGGCTGCCACGCTGTTTGACGTCATGAACACCCGTGCCTTTTTCCGTTCTCCCAGCCATAAGATTGCA
GAGTTCGCTGCCGGTGAAATTGGTGAGAAAGAGCACCTGAAAGCCAGCGAGCAGTATTCCTACGGTGCTG
ATCCGGTACGTGACGGGGTATCGACCGGTAAGGATATGGAGCGTCAGACGCTGGTCAGTTATTCCGACAT
TCAGTCTCTGCCGGATCTGACCTGTTATGTCACCCTGCCCGGACCGTATCCGGCAGTAAAACTCTCCCTG
AAATATCAGACACGACCGAAGGTCGCTCCGGAGTTTATTCCGCGTGACATCAACCCGGAAATGGAGAACC
GTCTGAGTGCCGTACTTGCCGCAAGGGAAGCAGAAGGTCGTGAGATGGCCAGCCTCTTCGAACCGGATGT
CCCGGAGGTTGTTTCCGGAGAAGACGTGACTCAGGCTGAACAGCCGCAACAGCCGGTGTCTCCTGCCATC
AACGATAAGAAGTCAGATGCAGGTGTGAATGTTTCGGCAGGGGGGATCGAGCAGGAGCTGAAAATGAAAC
CGGAAGAAGAGATGGAACAGCAACTGCCACCCGGGATCAGTGAATCCGGTGAAGTGGTGGATATGGCCGT
TTATGAGGCATGGCAACGGGAGCAGAATCCGGATATCCAGCAGAAGATGCAGCGTCGTGAAGAGGTGAAC
ATCAATGTGCACCGGGAGCGCGGGGAGAATGTTGAGCCGGGAGATGATTTCTGA
 Primer design