SecReT4
Protein ID: 169546476
T4SS name [ID]Tra_F [97]
Gene symbol-
Locus tagpVM01_p090
StrainEscherichia coli plasmid pVM01 (NC_010409)
Repliconplasmid pVM01 [GenBank: NC_010409] [Browse all T4SS(s) in this replicon]
Location [Strand]103687..106512 [-]
Productconjugal transfer mating pair stabilization protein TraG
Component typeTraG_F
UniProt IDB1P7R3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 8.3e-127, Aligned region: 3..450
Protein Sequence: 941 a.a.     [Download]
>gi|169546476|ref|YP_001711939.1| conjugal transfer mating pair stabilization protein TraG [Escherichia coli]
MNEVYVIAGGEWLRNNLNAIAAFMGTRTWDSIEKIALTLSVLAVAVMWVQRHNVMDLLGWVAVFVLISLL
VNVRTSVQIIDNSDLVKVHRVDNVPVGLAMPLSLTTRIGHAMVASYEMIFTQPDSVTYSKTGMLFGAEMV
SKSTDFLSRNPEIANIFQDYVQNCVMGDIYLNHKYTLEELMASADPYTLIFSRPSPLRGVYDSNNNFVTC
KDASVSLKDKLNLDTQSGGKTWHYYAQQLFGGRPDPNLLFSTLIGDSYSYFYGSSKSASQIIRQNVTINA
LKEGITSYAARNGDSASLVNLATTSSMEKQRLAHVSIGHVAMRTLPMTQTILTGIAIGIFPLLVLAAVFN
KLTLSVLKGYVFALMWLQSWPMLYAILNSAMTFYAKQNGAPVVLSEISQIQLKYSDLASTAGYLSMMIPP
LSWMMVRGLGAGFSSVYSHFASSAISPTASAAGSVVDGNYSYGNMQTENVNGFSWSTNSTTSFGQMMYQT
GSGATATQTRDGNMVMDASGAMSRLPVGINTTRQIAAAQQEMAREASNRAESALHGFSSSIASVWNTLSQ
FGSNRGSSDSVTGGADSTMSAQDSMMASRMRSAVESYAKAHNISNEQATRELASRSTTASAGLYGDAHAG
LDAKPSLFGVRVDVGAKVGGRASIDGSDLDSHEASSGSRASHDARHDIDARASKDFKEASDYFTSRKVSE
SGSHTDNNADSRVDQLSAALNSAKQSYDQYTTNMTRSHEYAEMASRTESMSGQMSEDLSQQFAQYVMKHA
PQDAEAILTNTSSPEIAERRRAMAWSFVQEQVQPGVDNAWRESRGDIGKGMESVPSGGGSQDIIADHQGH
QAIIEQRTQDSNIRNDVKHQVDNMVTEYRGNIGDTQSSIHGEENIVGRQYSELQNHHKTEALSQNNKYDE
ERESQKIIPEPSGEAVKEMIDGKKERLKGPL
 
Nucleotide Sequence: 2826 bp     [Download]
>gi|169546410|ref|NC_010409.1|:c106512-103687 Escherichia coli plasmid pVM01, complete sequence
GTGAATGAAGTTTATGTGATTGCCGGTGGTGAGTGGTTGCGGAATAACCTGAACGCCATTGCCGCCTTTA
TGGGAACCAGGACGTGGGATTCCATTGAAAAAATTGCGCTCACATTGTCTGTTCTCGCGGTGGCCGTAAT
GTGGGTACAGCGGCACAACGTGATGGATTTGCTGGGCTGGGTGGCCGTGTTTGTGCTTATCAGCCTGCTG
GTTAATGTCCGCACATCGGTGCAGATTATTGATAACAGTGACCTGGTCAAAGTTCACCGGGTGGATAATG
TGCCGGTCGGTCTGGCGATGCCACTTTCACTGACGACCCGCATCGGGCATGCAATGGTGGCCAGTTACGA
GATGATCTTCACGCAACCGGACAGTGTCACCTACAGCAAAACGGGGATGCTGTTTGGCGCAGAAATGGTA
TCAAAAAGCACCGACTTTTTGTCCCGGAATCCGGAAATCGCCAATATTTTCCAGGATTATGTGCAGAACT
GCGTGATGGGGGATATTTACCTGAACCACAAATACACGCTGGAGGAGCTGATGGCCTCCGCTGATCCCTA
CACGCTGATTTTTTCCCGCCCCAGCCCGCTGCGGGGCGTTTATGACAGCAATAATAATTTCGTAACCTGT
AAGGACGCGTCGGTTTCGCTGAAAGACAAGCTGAATCTGGACACACAGAGTGGCGGAAAAACCTGGCATT
ATTATGCCCAACAGCTATTTGGTGGACGCCCTGATCCGAACCTGTTGTTCAGTACGCTGATTGGCGACAG
TTACAGTTACTTCTATGGCTCAAGTAAATCAGCCAGCCAGATCATCCGCCAGAATGTTACCATCAATGCC
CTGAAGGAGGGGATCACCAGTTATGCCGCTCGTAATGGTGATTCGGCCAGCCTGGTGAATCTGGCCACCA
CCTCATCGATGGAGAAGCAACGTCTGGCACATGTCTCCATCGGCCATGTAGCGATGCGGACACTGCCCAT
GACGCAGACCATCCTGACGGGGATCGCCATTGGTATTTTCCCGCTCCTGGTACTGGCGGCTGTCTTCAAT
AAACTGACGCTGTCCGTCCTGAAAGGCTATGTGTTTGCCCTGATGTGGCTGCAGTCATGGCCAATGTTGT
ACGCCATTCTGAACAGTGCCATGACATTTTATGCGAAGCAGAATGGTGCACCGGTGGTGCTCTCGGAAAT
TTCACAGATACAGCTGAAATACTCCGATCTGGCCTCCACTGCCGGGTATCTTTCCATGATGATCCCGCCA
TTATCCTGGATGATGGTCAGGGGACTCGGGGCCGGATTTTCCAGTGTGTACAGCCATTTCGCTTCCTCTG
CTATCAGCCCGACTGCCAGTGCGGCAGGTAGTGTGGTTGACGGTAATTACTCCTACGGCAACATGCAGAC
GGAAAACGTGAACGGCTTCAGCTGGAGCACCAACAGCACCACGTCGTTTGGTCAGATGATGTACCAGACC
GGCAGTGGCGCAACTGCCACACAGACCCGTGACGGTAATATGGTGATGGATGCGAGCGGGGCGATGTCCC
GGTTACCGGTCGGCATCAATACAACGCGTCAGATTGCGGCGGCACAACAGGAAATGGCCCGGGAAGCATC
GAACAGAGCAGAAAGTGCCCTGCATGGGTTCAGCAGCAGTATTGCCAGTGTCTGGAACACGCTCAGTCAG
TTTGGTTCTAACCGGGGGAGCAGTGATTCTGTCACCGGTGGCGCTGACAGTACGATGAGTGCACAGGACT
CCATGATGGCCAGCCGTATGCGCAGTGCAGTGGAAAGCTATGCGAAGGCGCATAATATCAGTAATGAGCA
GGCGACAAGAGAACTGGCATCGAGAAGTACGACTGCATCAGCTGGATTGTATGGTGATGCTCATGCCGGA
TTAGATGCAAAGCCCAGCCTTTTTGGTGTGCGTGTTGATGTTGGCGCTAAGGTTGGTGGGCGAGCCAGTA
TTGACGGTAGTGATCTGGACTCACATGAAGCCAGTAGTGGCAGCAGGGCTTCCCATGATGCTCGCCATGA
TATTGACGCTAGAGCCAGTAAGGACTTTAAAGAGGCCAGCGATTACTTTACCAGTCGCAAAGTCAGTGAA
TCCGGCAGCCATACTGACAATAATGCCGATTCCCGTGTGGACCAGCTGTCTGCAGCCCTGAACTCAGCAA
AACAGAGTTACGACCAGTACACGACGAATATGACCCGCAGCCATGAATATGCTGAAATGGCATCCCGTAC
TGAAAGCATGAGTGGGCAGATGAGTGAAGACCTATCGCAACAGTTTGCACAGTATGTGATGAAACACGCT
CCGCAGGATGCAGAAGCTATTCTGACAAATACCAGTTCGCCGGAGATTGCAGAACGCCGTCGGGCAATGG
CGTGGTCTTTTGTGCAGGAACAGGTGCAGCCTGGTGTTGATAATGCCTGGCGTGAATCCCGTGGTGATAT
TGGTAAAGGAATGGAGAGCGTACCTTCGGGTGGTGGCAGCCAGGATATTATTGCTGACCATCAGGGACAT
CAGGCCATTATTGAGCAAAGAACGCAGGACAGTAATATCCGAAATGATGTAAAACATCAGGTTGATAATA
TGGTCACAGAATACCGAGGCAATATCGGGGATACTCAGAGCAGCATACATGGCGAAGAAAATATTGTAGG
AAGACAGTATTCTGAACTACAAAATCACCATAAAACAGAAGCATTATCTCAGAATAATAAATATGATGAA
GAGCGAGAAAGTCAAAAGATAATACCTGAGCCATCAGGAGAGGCTGTGAAAGAAATGATTGATGGTAAAA
AGGAACGACTGAAGGGGCCATTATGA
 Primer design