SecReT4
Protein ID: 169546477
T4SS name [ID]Tra_F [97]
Gene symbol-
Locus tagpVM01_p091
StrainEscherichia coli plasmid pVM01 (NC_010409)
Repliconplasmid pVM01 [GenBank: NC_010409] [Browse all T4SS(s) in this replicon]
Location [Strand]106509..107882 [-]
Productconjugal transfer pilus assembly protein TraH
Component typeTraH_F
UniProt IDB1P7R4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 2.9e-117, Aligned region: 29..378
Protein Sequence: 457 a.a.     [Download]
>gi|169546477|ref|YP_001711940.1| conjugal transfer pilus assembly protein TraH [Escherichia coli]
MLRIKPLFILCAALLTVTPAASADVNSDMNQFFNKLGFASNTTQPGVWQGQAAGYAYGGSLYARTQVKNV
QLISMTLPDINAGCGGIDAYLGSFSFINGEQLQRFVKQIMSNAAGYFFDLALQTTVPEIKTAKDFLQKMA
SDINSMNLSSCQAAQGIIGGLFPRTQVSQQKVCQDIAGESNIFADWAASRQGCTVGGKSDSVRDKASDKD
KERVTKNINIMWNALSKNRMFDGNKELKEFVMTLTGSLVFGPNGEITPLSARTTDRSIIRAMMEGGTAKI
YHCNDSDKCLKVVADTPVTISRDNALKSQITKLLASIQNKAVSDTPLDDKEKGFISSTTIPVFKYLVDPQ
MLGVSNSMIYQLTDYIGYDILLQYIQELIQQARAMVATGNYDEAVIGHINDNMNDATRQIAAFQSQVQVQ
QDALLVVDRQMSYMRQQLSARMLSRYQNNYHFGGSTL
 
Nucleotide Sequence: 1374 bp     [Download]
>gi|169546410|ref|NC_010409.1|:c107882-106509 Escherichia coli plasmid pVM01, complete sequence
ATGCTTCGCATTAAGCCTCTTTTTATTCTTTGTGCCGCCTTACTGACGGTGACGCCTGCAGCGTCAGCGG
ATGTGAACAGCGACATGAATCAGTTCTTTAACAAGCTGGGCTTCGCCTCCAATACCACACAGCCGGGCGT
CTGGCAGGGGCAGGCTGCCGGCTATGCTTACGGCGGCTCCCTGTATGCCCGTACTCAGGTCAAAAATGTT
CAGCTGATTTCCATGACGCTGCCGGATATCAATGCCGGATGTGGCGGCATCGACGCTTATCTCGGTTCGT
TCAGTTTTATTAATGGTGAGCAGCTGCAGCGTTTTGTTAAGCAGATTATGAGTAATGCTGCCGGTTACTT
TTTTGACCTTGCCCTGCAGACAACGGTGCCGGAAATCAAAACCGCAAAAGACTTCCTGCAGAAAATGGCA
AGCGACATTAACAGCATGAACCTCAGTTCCTGCCAGGCGGCGCAGGGGATTATCGGCGGGCTTTTCCCCC
GGACGCAGGTGTCCCAGCAAAAAGTCTGTCAGGACATTGCCGGTGAGAGCAATATTTTTGCTGACTGGGC
GGCTTCCCGGCAGGGATGTACCGTTGGCGGTAAATCTGACAGCGTCAGGGATAAAGCCAGCGACAAGGAT
AAGGAGCGGGTGACCAAAAACATTAACATCATGTGGAATGCGCTTTCCAAAAACAGAATGTTTGACGGCA
ACAAAGAGCTGAAAGAGTTTGTGATGACGCTGACCGGCTCACTGGTGTTTGGTCCCAACGGCGAAATCAC
ACCGCTGTCAGCCAGAACCACTGACCGCTCAATTATCCGGGCCATGATGGAAGGCGGCACAGCAAAAATT
TATCACTGCAACGATTCTGATAAATGCCTGAAAGTGGTGGCAGACACACCGGTGACCATCAGCCGGGATA
ATGCACTGAAGTCTCAGATTACTAAACTTCTGGCCAGCATTCAGAACAAGGCTGTCAGTGACACGCCTCT
GGATGACAAGGAAAAAGGCTTTATTTCCAGTACCACCATCCCCGTCTTCAAATACCTGGTTGACCCGCAG
ATGCTCGGTGTTTCCAACAGTATGATTTACCAGCTGACGGACTATATCGGTTACGACATCCTGCTGCAGT
ACATTCAGGAGCTGATACAGCAGGCCCGGGCGATGGTGGCCACGGGAAATTATGACGAAGCGGTTATCGG
GCATATTAACGACAACATGAATGATGCCACCCGGCAGATTGCGGCGTTTCAGTCACAGGTGCAGGTACAG
CAGGATGCGCTGCTGGTTGTCGATCGTCAGATGAGCTACATGCGTCAGCAGCTTTCCGCCCGCATGCTCA
GTCGTTACCAGAACAACTATCACTTCGGAGGGAGCACGCTGTGA
 Primer design