SecReT4
Protein ID: 169546480
T4SS name [ID]Tra_F [97]
Gene symbol-
Locus tagpVM01_p095
StrainEscherichia coli plasmid pVM01 (NC_010409)
Repliconplasmid pVM01 [GenBank: NC_010409] [Browse all T4SS(s) in this replicon]
Location [Strand]109051..109332 [-]
Productconjugal transfer pilin chaperone TraQ
Component typeTraQ_F
UniProt IDB1P7R8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraQ [PF09679], Evalue: 9.3e-52, Aligned region: 1..93
Protein Sequence: 93 a.a.     [Download]
>gi|169546480|ref|YP_001711944.1| conjugal transfer pilin chaperone TraQ [Escherichia coli]
MHKYKFSLPRLDITGMWVFSLGVWFHIVARLVYSKPWMAFFLAELIAAILVLFGAYQVLDAWIARVSREE
REALEARQQAMMEGQQEGRHVSH
 
Nucleotide Sequence: 282 bp     [Download]
>gi|169546410|ref|NC_010409.1|:c109332-109051 Escherichia coli plasmid pVM01, complete sequence
GTGCATAAATATAAATTCTCTTTACCCCGGCTTGATATTACGGGAATGTGGGTATTTTCCCTGGGTGTCT
GGTTTCATATCGTCGCCCGTCTTGTTTACAGCAAACCCTGGATGGCTTTTTTTCTGGCGGAGCTTATTGC
GGCCATTCTCGTGCTGTTCGGCGCATACCAGGTGCTGGATGCATGGATTGCCCGTGTCAGCCGGGAAGAG
CGTGAGGCACTGGAAGCCAGGCAACAGGCCATGATGGAAGGGCAGCAGGAGGGCAGACATGTCTCTCATT
AA
 Primer design