SecReT4
Protein ID: 169546481
T4SS name [ID]Tra_F [97]
Gene symbol-
Locus tagpVM01_p096
StrainEscherichia coli plasmid pVM01 (NC_010409)
Repliconplasmid pVM01 [GenBank: NC_010409] [Browse all T4SS(s) in this replicon]
Location [Strand]109448..110191 [-]
Productconjugal pilus assembly protein TraF
Component typeTraF_F
UniProt IDB1P7R9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 1.4e-78, Aligned region: 23..237
Protein Sequence: 247 a.a.     [Download]
>gi|169546481|ref|YP_001711945.1| conjugal pilus assembly protein TraF [Escherichia coli]
MNKALLPLLLCCFIFPASGKDAGWQWYNEKINPKEKENKPVPAAPRQEPDIMQKLAALQTATKRALYEAI
LYPGVDNFVKYFRLQNYWTQQAGLFTMSAKKAMLAHPELDYNLQYSHYNGTVRNQLAADQVQQRQAIAKL
AEHYGIMFFYRGQDPIDGQLAQVINGFRDTYGLSVIPVSVDGVINPLLPDSRTDQGQAQRLGVKYFPAMM
LVDPKQGSVRPLSYGFISQDDLAKQFLNVSEDFKPNF
 
Nucleotide Sequence: 744 bp     [Download]
>gi|169546410|ref|NC_010409.1|:c110191-109448 Escherichia coli plasmid pVM01, complete sequence
ATGAATAAAGCATTACTGCCACTGTTACTCTGCTGCTTTATTTTTCCGGCGTCAGGGAAAGATGCAGGCT
GGCAGTGGTATAACGAGAAAATAAATCCGAAGGAAAAAGAAAATAAACCTGTACCTGCAGCACCCCGTCA
GGAACCGGATATTATGCAGAAACTGGCCGCGCTGCAGACGGCAACAAAGCGGGCGCTGTACGAAGCTATT
CTGTATCCCGGCGTGGATAATTTTGTGAAATATTTCCGGCTGCAGAATTACTGGACTCAGCAGGCCGGGC
TTTTCACCATGAGCGCCAAAAAAGCCATGCTGGCGCATCCCGAACTGGACTATAACCTGCAGTACAGCCA
TTACAACGGCACGGTCCGTAACCAGCTGGCGGCAGACCAGGTGCAGCAGCGACAGGCCATTGCGAAACTG
GCTGAACACTACGGCATTATGTTTTTTTACCGGGGGCAGGACCCCATTGACGGGCAGCTGGCGCAGGTCA
TTAATGGCTTCCGGGATACGTATGGTCTGAGTGTTATTCCCGTTTCCGTGGATGGCGTGATTAATCCACT
GTTGCCGGATTCCCGGACTGACCAGGGGCAGGCGCAGCGCCTCGGCGTGAAATATTTCCCGGCCATGATG
CTGGTTGACCCGAAACAGGGCAGTGTTCGCCCGTTATCATACGGTTTTATTTCGCAGGACGACCTGGCAA
AACAGTTCCTGAACGTTTCTGAAGATTTTAAACCGAACTTCTGA
 Primer design