SecReT4
Protein ID: 169546483
T4SS name [ID]Tra_F [97]
Gene symbol-
Locus tagpVM01_p098
StrainEscherichia coli plasmid pVM01 (NC_010409)
Repliconplasmid pVM01 [GenBank: NC_010409] [Browse all T4SS(s) in this replicon]
Location [Strand]110468..112318 [-]
Productconjugal transfer mating pair stabilization protein TraN
Component typeTraN_F
UniProt IDB1P7S1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 3.4e-76, Aligned region: 322..566
Protein Sequence: 616 a.a.     [Download]
>gi|169546483|ref|YP_001711947.1| conjugal transfer mating pair stabilization protein TraN [Escherichia coli]
MKRMLPLILALVAGMAQADSNSDYRAGSDFAHQIKGQGSSSIQGFKPQESIPGYNAHPDETKYYGGVTAG
GDGGLKNDGTTEWATGETGKTITESFMNKPKDILSPDAPFIQTGRDVVNRADSIVGNTGQQCSAQQINRS
EFTNYTCERDTMVEEYCTRTARITGDWKYTDEYREVTIPHSQFRFSMNGLKLVFSVTAPVTGTVESASLS
VYAAFFFLNSRYTFMNSTFNVGLVNGQSGTFPLSGATGLQVTQGQVLTGSGCTANGNCLSGGNGDRQVYE
KLASGASTFTLKLRMKVRDKEWVPRVEWVESCPFNKADGVLKGTECSEPGGTKTGVMEGKPWSITQACWA
YRDKYVTQSADNGTCQKYVDNPACTLASRQCAFYSDEGTCLHEYATYSCESKTSGKVMVCGGDVFCLDGE
CDKAQSGKNSDFGAAVSQLAALAAAGKDVAALNGVDVRAFTGEAKFCRKAAAGFSNCCKDGGWGQDVGLA
KCNSEEKALGKAKDNKLTVSVGEFCSKKVLGVCLQKKRSYCQFDSKLAQIVQQQGRNGQLRIGFGSAKSP
DCRGITVDELQRIKFDQLDFTNFYEDLMNNQKIPDSGVLTQKVKEQIADQLKQAGQ
 
Nucleotide Sequence: 1851 bp     [Download]
>gi|169546410|ref|NC_010409.1|:c112318-110468 Escherichia coli plasmid pVM01, complete sequence
ATGAAACGTATGTTACCTCTGATACTGGCTCTGGTTGCCGGCATGGCACAGGCTGACAGCAACAGTGATT
ACCGGGCCGGTTCTGATTTTGCTCACCAGATCAAAGGACAGGGAAGCAGCAGTATTCAGGGCTTTAAGCC
ACAGGAGAGCATCCCCGGCTATAACGCGCATCCGGACGAGACAAAATATTACGGTGGCGTGACTGCCGGC
GGGGATGGCGGCCTGAAAAATGACGGCACCACGGAATGGGCGACCGGTGAAACCGGAAAAACCATCACAG
AGTCCTTCATGAACAAGCCGAAAGACATTCTTTCACCGGATGCACCGTTCATTCAGACCGGCAGGGATGT
GGTGAACCGGGCTGACAGCATTGTGGGAAACACAGGCCAGCAGTGTAGTGCACAGCAGATAAACCGCAGT
GAATTCACAAACTATACCTGTGAACGGGACACGATGGTGGAGGAGTATTGCACACGGACTGCCAGGATCA
CCGGAGACTGGAAATACACAGATGAATATCGTGAGGTGACGATACCGCACTCACAGTTCCGGTTCAGTAT
GAACGGGCTGAAACTGGTGTTCAGTGTCACGGCTCCGGTAACCGGTACAGTGGAAAGTGCATCATTGTCT
GTATACGCCGCTTTTTTCTTCCTGAACTCTCGTTATACCTTCATGAATTCAACGTTCAATGTTGGCCTGG
TAAACGGGCAGTCGGGTACTTTCCCCCTGTCCGGGGCGACAGGTTTGCAGGTGACACAAGGGCAGGTTCT
GACCGGCAGTGGCTGTACTGCTAACGGTAACTGTCTTTCTGGCGGGAACGGTGACCGACAGGTTTATGAG
AAACTGGCCAGCGGCGCGTCCACCTTTACACTGAAACTCAGGATGAAGGTCCGTGATAAAGAATGGGTTC
CACGGGTGGAGTGGGTGGAGAGTTGTCCGTTTAATAAAGCGGATGGCGTGCTGAAAGGCACTGAGTGTTC
AGAGCCGGGTGGTACGAAAACTGGTGTGATGGAAGGTAAACCCTGGAGCATCACACAGGCGTGCTGGGCA
TACCGGGATAAATATGTCACACAGTCCGCAGATAATGGTACCTGTCAGAAATATGTCGATAATCCGGCCT
GTACGCTGGCCTCACGTCAGTGCGCGTTTTATTCCGATGAGGGAACCTGTCTGCATGAGTATGCCACGTA
CTCCTGCGAGTCAAAAACATCAGGAAAAGTGATGGTCTGTGGTGGTGATGTCTTCTGCCTTGACGGTGAA
TGCGATAAGGCGCAGAGCGGAAAAAACAGTGATTTTGGTGCAGCCGTATCACAGCTGGCTGCGCTTGCCG
CTGCTGGTAAGGATGTTGCCGCCCTGAATGGTGTGGATGTCAGGGCTTTCACCGGCGAGGCTAAATTCTG
CCGTAAGGCCGCAGCCGGCTTCAGTAACTGCTGTAAGGATGGTGGCTGGGGTCAGGATGTGGGTCTGGCG
AAGTGTAACAGTGAAGAAAAGGCGCTGGGAAAGGCAAAGGACAACAAACTGACGGTGAGTGTTGGCGAGT
TCTGTTCGAAAAAGGTACTCGGTGTCTGCCTGCAGAAAAAGCGCAGCTACTGCCAGTTTGATTCGAAACT
GGCGCAGATAGTCCAGCAGCAGGGGCGTAACGGGCAGCTGCGTATCGGGTTTGGCAGCGCCAAAAGTCCT
GACTGTCGTGGAATAACCGTGGATGAACTGCAGCGTATTAAGTTCGACCAGCTGGACTTCACTAACTTCT
ACGAAGACCTGATGAATAACCAGAAAATCCCGGACAGTGGTGTTCTGACGCAGAAAGTGAAAGAACAGAT
TGCTGACCAGCTGAAACAGGCAGGACAGTAA
 Primer design