SecReT4
Protein ID: 169546484
T4SS name [ID]Tra_F [97]
Gene symbol-
Locus tagpVM01_p099
StrainEscherichia coli plasmid pVM01 (NC_010409)
Repliconplasmid pVM01 [GenBank: NC_010409] [Browse all T4SS(s) in this replicon]
Location [Strand]112315..112953 [-]
Productconjugal transfer pilus assembly protein TrbC
Component typeTrbC_F
UniProt IDB1P7S2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 5.4e-28, Aligned region: 93..191
Protein Sequence: 212 a.a.     [Download]
>gi|169546484|ref|YP_001711948.1| conjugal transfer pilus assembly protein TrbC [Escherichia coli]
MNWKIFALFALTAGMHITVHASDNVNTPENRQFLKQQENLSRQLREKPDHQLKAWAEKQVLENPLQRSDN
HFLDELVRKQQASQDGKPRQGALYFVSFSIPEEGLKRMLGETRHYGIPATLRGMVNNDLKTTAEAVLSLV
KDGATDGVQIDPTLFSQYGIRSVPTLVVFCSQGYDIIRGNLRVGQALEKVAATGDCRQVAHDLLAGKGDS
GK
 
Nucleotide Sequence: 639 bp     [Download]
>gi|169546410|ref|NC_010409.1|:c112953-112315 Escherichia coli plasmid pVM01, complete sequence
ATGAACTGGAAAATATTTGCGCTTTTTGCCCTGACTGCAGGAATGCATATCACTGTTCATGCCTCAGACA
ATGTGAACACTCCTGAAAACCGCCAGTTCCTGAAGCAGCAGGAAAATTTAAGCAGACAACTGCGTGAAAA
ACCTGACCATCAGCTGAAGGCCTGGGCGGAGAAACAGGTGCTGGAGAACCCCCTTCAGCGTTCAGATAAC
CATTTCCTGGATGAGCTGGTTCGTAAACAGCAGGCTTCGCAGGACGGGAAACCCCGGCAGGGTGCTCTGT
ATTTTGTGTCGTTTTCCATTCCCGAAGAGGGGCTGAAACGGATGCTGGGCGAAACCCGGCACTACGGTAT
ACCCGCCACACTGCGGGGCATGGTGAACAATGACCTGAAGACCACCGCTGAAGCCGTGCTGTCCCTGGTG
AAAGACGGCGCGACTGATGGTGTTCAGATCGACCCGACGCTGTTTTCACAGTACGGCATTCGCAGCGTAC
CGACACTGGTGGTGTTCTGCAGTCAGGGATACGACATCATCCGGGGAAACCTGCGGGTCGGCCAGGCGCT
GGAGAAAGTGGCCGCCACGGGTGACTGCCGGCAGGTGGCTCATGATTTACTGGCAGGGAAAGGAGATTCC
GGGAAATGA
 Primer design