SecReT4
Protein ID: 169546512
T4SS name [ID]Tra_F [97]
Gene symbol-
Locus tagpVM01_p102
StrainEscherichia coli plasmid pVM01 (NC_010409)
Repliconplasmid pVM01 [GenBank: NC_010409] [Browse all T4SS(s) in this replicon]
Location [Strand]113950..114942 [-]
Productconjugal transfer pilus assembly protein TraU
Component typeTraU_F
UniProt IDQ0E823, B7LI78
KEGG IDecz:pECS88_0080
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 2.4e-84, Aligned region: 29..329
Protein Sequence: 330 a.a.     [Download]
>gi|169546512|ref|YP_001711951.1| conjugal transfer pilus assembly protein TraU [Escherichia coli]
MKRSLWLLMLFLLAGHVPAASADSACEGRFVNPITDICWSCIFPLSLGSIKVSQGKVPDTANPSMPIQIC
PAPPPLFRRIGLAIGYWEPMALTDVTRSPGCMVNLGFSLPAFGKTAQGTAKKDEKQVNGAFYHVHWYKYP
LTYWLNIITSLGCLEGGDLDIAYLSEIDPTWTDSSLTTILNPEAVIFANPIAQGACAADAIASAFNMPLD
VLFWCAGSQGSMYPFNGWVSNESSPLQSSLLVSERMAFKLHRQGMIMETIGKNNAVCNEYPSPILPKERW
RYQMVNMYPDSGQCHPFGRSVTRWETGKNPPNTKKNFGYLMWRKRNCVFL
 
Nucleotide Sequence: 993 bp     [Download]
>gi|169546410|ref|NC_010409.1|:c114942-113950 Escherichia coli plasmid pVM01, complete sequence
ATGAAGCGAAGCCTGTGGCTGCTGATGTTATTCCTTCTCGCCGGTCATGTCCCTGCAGCGTCTGCGGATT
CTGCCTGTGAGGGGCGTTTTGTAAACCCGATCACGGATATCTGCTGGAGCTGTATTTTCCCGCTCTCGCT
GGGCAGTATCAAAGTCAGTCAGGGTAAGGTCCCCGACACGGCGAACCCGTCGATGCCCATTCAGATTTGT
CCGGCACCGCCGCCGCTGTTCAGGCGTATCGGGCTGGCCATTGGTTACTGGGAGCCGATGGCGCTGACGG
ACGTCACCCGGTCACCGGGATGCATGGTTAACCTGGGCTTCAGCCTGCCGGCTTTTGGTAAAACGGCACA
GGGAACGGCGAAAAAAGATGAGAAGCAGGTGAACGGGGCGTTCTATCACGTTCACTGGTACAAATACCCG
CTGACGTACTGGCTTAACATCATCACATCGCTGGGCTGTCTGGAAGGTGGTGACCTGGATATCGCTTATC
TTTCTGAAATTGACCCCACCTGGACGGACAGCAGCCTGACCACCATTCTCAATCCGGAAGCTGTCATCTT
TGCCAATCCGATAGCACAGGGAGCCTGCGCAGCAGATGCGATTGCCAGCGCCTTTAATATGCCTCTCGAT
GTTCTGTTCTGGTGTGCCGGTTCGCAGGGAAGTATGTACCCGTTCAATGGCTGGGTGAGTAATGAGTCCA
GTCCGTTGCAGTCCTCCCTGCTGGTCAGTGAACGCATGGCGTTCAAGCTGCACCGTCAGGGCATGATTAT
GGAAACCATCGGGAAAAATAACGCCGTCTGTAATGAATATCCGTCCCCAATCCTGCCCAAAGAACGCTGG
CGTTACCAGATGGTGAATATGTATCCGGACAGCGGGCAGTGCCACCCGTTCGGGCGCAGCGTGACCCGCT
GGGAAACCGGGAAAAATCCGCCCAACACAAAGAAAAACTTCGGCTACCTGATGTGGCGTAAACGTAACTG
TGTTTTCCTGTAA
 Primer design