SecReT4
Protein ID: 169546513
T4SS name [ID]Tra_F [97]
Gene symbol-
Locus tagpVM01_p103
StrainEscherichia coli plasmid pVM01 (NC_010409)
Repliconplasmid pVM01 [GenBank: NC_010409] [Browse all T4SS(s) in this replicon]
Location [Strand]114939..115571 [-]
Productconjugal transfer pilus assembly protein TraW
Component typeTraW_F
UniProt IDP18472, Q7B3W1, B7LI77
KEGG IDecz:pECS88_0079
PDB IDNA
Domain hit(s) vs Pfam TraW_N [PF12477], Evalue: 7.6e-11, Aligned region: 1..30
Protein Sequence: 210 a.a.     [Download]
>gi|169546513|ref|YP_001711952.1| conjugal transfer pilus assembly protein TraW [Escherichia coli]
MRCRGLIALLIWGQSVAAADLGTWGDLWPVKEPDMLTVIMQRLTALEQSGEMGRKMDAFKERVIRNSLRP
PAVPGIGRTEKYGSRLFDPSVRLAADIRDNEGRVFARQGEVMNPLQYVPFNQTLYFINGDDPAQVAWMKR
QTPPTLESKIILVQGSIPEMQKSLDSRVYFDQNGVLCQRLGIDQVPARVSAVPGDRFLKVEFIPAEEGRK
 
Nucleotide Sequence: 633 bp     [Download]
>gi|169546410|ref|NC_010409.1|:c115571-114939 Escherichia coli plasmid pVM01, complete sequence
ATGAGATGCCGGGGGCTGATTGCCCTGCTGATATGGGGGCAGAGTGTGGCCGCCGCCGATCTTGGTACCT
GGGGCGATCTGTGGCCGGTAAAGGAGCCGGACATGCTGACGGTGATCATGCAGCGCCTGACGGCACTGGA
GCAGTCCGGTGAGATGGGCCGGAAAATGGATGCCTTTAAGGAGCGGGTGATCCGCAACAGTCTGCGGCCC
CCTGCCGTGCCCGGTATCGGACGCACGGAGAAATACGGTAGCCGGTTGTTTGACCCGTCCGTCAGACTGG
CTGCGGATATCCGGGATAACGAAGGGCGGGTGTTTGCCCGTCAGGGTGAAGTGATGAATCCGCTGCAGTA
TGTTCCTTTTAACCAGACGCTGTATTTCATCAATGGCGATGATCCGGCGCAGGTGGCCTGGATGAAACGC
CAGACGCCGCCCACACTGGAGAGCAAAATCATCCTCGTGCAGGGCAGTATCCCGGAGATGCAGAAGTCTC
TGGACAGCCGTGTTTACTTTGACCAGAACGGTGTGCTCTGCCAGCGCCTCGGCATTGATCAGGTCCCGGC
ACGGGTGAGCGCCGTTCCCGGCGATCGCTTCCTGAAGGTGGAATTTATTCCGGCAGAGGAGGGCAGAAAA
TGA
 Primer design