SecReT4
Protein ID: 169546515
T4SS name [ID]Tra_F [97]
Gene symbol-
Locus tagpVM01_p105
StrainEscherichia coli plasmid pVM01 (NC_010409)
Repliconplasmid pVM01 [GenBank: NC_010409] [Browse all T4SS(s) in this replicon]
Location [Strand]115951..118581 [-]
Productconjugal transfer ATP-binding protein TraC
Component typeTraC_F
UniProt IDB1P7S8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 2.7e-58, Aligned region: 38..278
AAA_10 [PF12846], Evalue: 4.2e-43, Aligned region: 480..773
DUF87 [PF01935], Evalue: 1e-05, Aligned region: 483..670
TrwB_AAD_bind [PF10412], Evalue: 5.6e-05, Aligned region: 480..518
Protein Sequence: 876 a.a.     [Download]
>gi|169546515|ref|YP_001711954.1| conjugal transfer ATP-binding protein TraC [Escherichia coli]
MSNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAI
PINGANESIVEALDHMLRTKLPRGVPFCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMNAA
ATQFPLPEGMNLPLTLRHYRVFFSYCSPSKKKSRADILEMENLVKIIRASLQGASITTQAVDAQAFIDIV
GEMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAF
LWNMADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWG
ELRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGK
GLFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSG
AGKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLS
VMASPNGNLDEVHEGLLLQAVRASWLAKKNKARIDDVVDFLKNARDNDQYVESPTIRSRLDEMIVLLDQY
TANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGW
RLLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKY
NQLYPDQFLPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEG
LSIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA
 
Nucleotide Sequence: 2631 bp     [Download]
>gi|169546410|ref|NC_010409.1|:c118581-115951 Escherichia coli plasmid pVM01, complete sequence
ATGAGTAATAACCCACTTGAGGCCGTCACTCAGGCGGTTAACTCCCTCGTCACAGCACTGAAACTGCCTG
ACGAATCCGCAAAGGCCAATGAAGTTCTGGGCGAAATGAGCTTCCCGCAGTTCAGCCGTCTGCTGCCGTA
CCGTGATTATAACCAGGAATCCGGTCTGTTCATGAATGACACCACGATGGGCTTTATGCTGGAAGCCATT
CCCATCAATGGGGCGAATGAGTCTATTGTGGAGGCGCTCGACCACATGCTGCGCACCAAACTGCCGCGCG
GAGTGCCGTTCTGCATCCATCTGATGTCCAGTCAGCTTGTTGGTGACAGAATTGAATACGGGCTGCGTGA
GTTCTCCTGGTCCGGTGAACAGGCTGAACGGTTTAACGCCATTACCCGTGCCTATTATATGAACGCGGCA
GCGACACAGTTTCCGCTGCCGGAGGGGATGAATCTGCCCCTGACCCTGCGCCATTACCGGGTATTCTTCT
CGTACTGTTCTCCCTCGAAGAAAAAAAGCCGGGCTGACATTCTGGAAATGGAAAACCTGGTGAAAATCAT
CCGGGCGTCGTTACAGGGGGCCAGTATCACCACACAGGCGGTGGATGCACAGGCCTTTATCGATATTGTC
GGGGAGATGATTAACCATAACCCGGACTCCCTGTATCCGAAAAGACGTCAGCTGGACCCGTATTCTGATC
TGAATTATCAGTGTGTGGAGGACAGTTTTGACCTGAAAGTCCGGGCGGATTACCTGACGCTGGGCCTGCG
TGAGAACGGCAGGAACAGCACGGCCCGCATCCTGAATTTCCATCTGGCCCGTAACCCGGAAATCGCCTTC
CTGTGGAACATGGCCGACAACTACAGCAACCTGCTGAACCCGGAACTGTCCATCTCCTGTCCGTTCATCC
TGACGCTGACTCTGGTGGTGGAAGACCAGGTGAAAACTCACAGCGAAGCCAACCTGAAGTACATGGACCT
GGAGAAAAAGTCGAAGACCTCCTATGCCAAATGGTTTCCGTCCGTGGAGAAAGAGGCGAAGGAGTGGGGG
GAACTGCGTCAGCGGCTGGGCTCCGGTCAGTCCTCTGTCGTGTCCTACTTCCTCAACATCACAGCATTCT
GCAAGGACAATAATGAAACGGCGCTGGAAGTGGAGCAGGACATCCTGAACAGCTTCCGTAAAAACGGTTT
TGAGCTGATTTCACCGCGCTTTAACCACATGCGCAATTTCCTGACCTGTCTGCCCTTTATGGCCGGGAAA
GGGTTGTTTAAACAGCTGAAAGAGGCCGGAGTGGTACAGCGCGCAGAGAGCTTTAATGTGGCCAACCTGA
TGCCGTTAGTGGCGGATAACCCCCTGACACCGGCAGGTCTGCTGGCACCCACCTACCGTAACCAGCTGGC
GTTTATCGATATTTTCTTCCGGGGGATGAATAACACCAACTACAACATGGCGGTCTGTGGCACCTCCGGG
GCCGGTAAAACCGGGCTGATACAGCCACTTATCCGCAGCGTGCTGGACTCCGGGGGCTTTGCCGTGGTGT
TCGACATGGGGGATGGCTACAAGTCCCTGTGTGAGAACATGGGCGGGGTGTATCTGGACGGTGAAACCCT
GCGTTTTAACCCGTTTGCGAACATCACCGATATTGACCAGTCAGCGGAGCGTGTCCGCGACCAGTTGTCG
GTGATGGCCAGCCCCAACGGTAACCTGGATGAAGTGCATGAAGGTCTGCTGCTGCAGGCGGTCAGGGCCT
CCTGGCTGGCTAAAAAGAATAAGGCGCGCATCGATGATGTGGTGGATTTCCTGAAAAACGCCCGTGATAA
CGACCAGTATGTAGAGTCACCGACTATCCGCAGCCGTCTGGACGAAATGATTGTGCTGCTTGACCAGTAC
ACTGCTAACGGCACTTATGGCCAGTATTTCAACTCCGATGAGCCGTCCCTGCGGGATGATGCGAAAATGG
TGGTGCTGGAGCTGGGCGGACTGGAAGACCGTCCGTCCCTGCTGGTTGCGGTGATGTTCAGCCTTATCAT
TTACATTGAGAACCGGATGTACCGCACGCCGCGTAACCTCAAGAAACTGAACGTTATTGATGAAGGCTGG
CGTCTGCTGGACTTCAAAAATCACAAGGTCGGTGAATTTATTGAGAAAGGCTACCGTACGGCCCGCCGTC
ATACCGGTGCCTATATCACCATCACACAGAACATCGTCGACTTTGACTCTGATAAGGCCTCCAGTGCTGC
CCGCGCGGCATGGGGTAACTCCTCCTACAAAATTATCCTCAAACAGAGTGCGAAGGAGTTCGCGAAATAC
AACCAGCTGTATCCGGACCAGTTCCTGCCACTGCAGCGCGACATGATTGGTAAGTTTGGTGCAGCCAAAG
ACCAGTGGTTCAGTTCCTTCCTGCTGCAGGTGGAAAACCATTCCTCCTGGCACCGTCTGTTTGTGGACCC
GTTAAGCCGCGCCATGTACAGCTCTGACGGCCCGGATTTTGAGTTTGTGCAGCAGAAGCGTAAAGAGGGG
CTGAGTATTCATGAGGCAGTGTGGCAGCTGGCGTGGAAGAAGTCAGGGCCGGAGATGGCTTCGCTGGAAG
CCTGGCTGGAAGAACATGAGAAATACAGGAGTGTGGCATGA
 Primer design