SecReT4
Protein ID: 169546520
T4SS name [ID]Tra_F [97]
Gene symbol-
Locus tagpVM01_p110
StrainEscherichia coli plasmid pVM01 (NC_010409)
Repliconplasmid pVM01 [GenBank: NC_010409] [Browse all T4SS(s) in this replicon]
Location [Strand]120139..120654 [-]
Productconjugal transfer protein TraV
Component typeTraV_F
UniProt IDB1P7T3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 2.5e-39, Aligned region: 23..165
Protein Sequence: 171 a.a.     [Download]
>gi|169546520|ref|YP_001711959.1| conjugal transfer protein TraV [Escherichia coli]
MKKISLFIPLLGTLLLSGCAGTNTEFECNATTSDTCMTMEQANEKAKKLEQSSEAKPVAASLPRLAEGYF
RTMPVQTVTATTPSGSRPAVTAHPEQKLLAPRPLFTAAREVKTVVPVSSVTPVTPPRPLRTGEQTAALWI
APYIDNQDVYHQPSSVFFVIKPSAWGKPRIN
 
Nucleotide Sequence: 516 bp     [Download]
>gi|169546410|ref|NC_010409.1|:c120654-120139 Escherichia coli plasmid pVM01, complete sequence
ATGAAAAAGATTTCTTTATTTATTCCTCTGCTGGGGACGTTATTACTTTCTGGCTGTGCCGGAACTAATA
CGGAATTTGAGTGTAACGCCACCACATCAGATACCTGTATGACGATGGAGCAGGCCAATGAGAAGGCCAA
AAAACTGGAGCAGTCCTCAGAAGCAAAGCCGGTTGCGGCATCACTGCCGCGCCTGGCTGAAGGGTACTTC
CGGACAATGCCGGTGCAGACCGTCACCGCGACCACTCCGTCCGGCAGCAGACCTGCGGTGACAGCACATC
CGGAGCAGAAACTGCTGGCACCACGCCCGCTGTTTACCGCTGCCCGGGAAGTGAAAACGGTTGTTCCGGT
CAGTTCAGTTACGCCGGTAACACCTCCTCGTCCGCTAAGAACGGGTGAGCAGACGGCAGCATTATGGATA
GCGCCTTATATTGATAACCAGGATGTTTATCATCAGCCATCCAGCGTGTTTTTTGTTATTAAACCGTCTG
CGTGGGGAAAACCACGTATTAATTAA
 Primer design