SecReT4
Protein ID: 169546523
T4SS name [ID]Tra_F [97]
Gene symbol-
Locus tagpVM01_p113
StrainEscherichia coli plasmid pVM01 (NC_010409)
Repliconplasmid pVM01 [GenBank: NC_010409] [Browse all T4SS(s) in this replicon]
Location [Strand]121538..122965 [-]
Productconjugal transfer pilus assembly protein TraB
Component typeTraB_F
UniProt IDQ5JBM3, P41067, B7LI69
KEGG IDecz:pECS88_0070
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 2.9e-40, Aligned region: 213..409
CALCOCO1 [PF07888], Evalue: 4.6e-05, Aligned region: 68..121
Protein Sequence: 475 a.a.     [Download]
>gi|169546523|ref|YP_001711962.1| conjugal transfer pilus assembly protein TraB [Escherichia coli]
MASINTIVKRKQYLWLGIVVVGTASAIGGALYLSDVDMSGNGETVAEQEPVPDMTGVVDTTFDDKVRQHA
TTEMQVTAAQMQKQYEEIRRELDVLNKQRGDDQRRIEKLGQDNAALAEQVKALGANPVTATGEPVPQMPA
SPPGPEGEPQPGNTPVSFPPQGSVAVPPPTAFYPGNGVTPPPQVTYQSVPVPNRIQRKVFTRNEGKQGPS
LPYIPSGSFAKAMLIEGADANASVTGNESTVPMQLRITGLVEMPNSKTYDATGCFVGLEAWGDVSSERAI
VRTRNISCLKDGKTIDMPIKGHVSFRGKNGIKGEVVMRNGKILGWAWGAGFVDGIGQGMERASQPAVGLG
ATAAYGAGDVLKMGIGGGASKAAQTLSDYYIKRAEQYHPVIPIGAGNEVTVVFQDGFQLKTVEEMALERT
QSRAEEDNPESPVPVPPSAESHLNGFNTDQMLKQLGNLNPQQFMSGSQGGGNDGK
 
Nucleotide Sequence: 1428 bp     [Download]
>gi|169546410|ref|NC_010409.1|:c122965-121538 Escherichia coli plasmid pVM01, complete sequence
ATGGCCAGTATCAATACCATTGTGAAACGCAAGCAGTACCTGTGGCTGGGGATTGTGGTTGTCGGTACAG
CCTCCGCGATTGGTGGGGCACTGTATCTGTCTGATGTGGACATGTCCGGTAACGGTGAAACCGTGGCTGA
ACAGGAGCCTGTGCCGGATATGACCGGTGTGGTGGATACGACCTTTGATGACAAGGTGCGTCAGCATGCC
ACCACCGAGATGCAGGTGACGGCAGCGCAGATGCAGAAGCAGTATGAGGAAATCCGTCGTGAGCTGGATG
TTCTGAACAAACAGCGCGGTGATGACCAGCGTCGTATTGAAAAGTTGGGACAGGACAATGCCGCCCTGGC
AGAGCAGGTAAAAGCCCTGGGTGCTAATCCCGTCACGGCGACCGGTGAGCCTGTACCGCAGATGCCTGCC
TCACCGCCCGGCCCGGAAGGCGAACCACAGCCAGGAAACACCCCCGTATCCTTCCCGCCGCAGGGCAGCG
TTGCTGTTCCACCGCCGACGGCGTTTTATCCCGGGAATGGTGTCACGCCACCACCACAGGTGACGTACCA
GTCTGTGCCGGTGCCTAACCGGATACAGCGTAAGGTGTTTACCCGTAATGAGGGAAAACAGGGACCATCA
CTGCCGTACATTCCGTCAGGAAGTTTTGCGAAAGCCATGCTGATTGAAGGGGCGGATGCCAATGCCTCTG
TCACCGGTAATGAATCCACGGTGCCGATGCAGCTGCGTATCACCGGCCTGGTGGAAATGCCGAACAGCAA
GACGTATGACGCAACGGGATGTTTTGTGGGTCTGGAAGCCTGGGGGGATGTGTCCAGTGAGCGTGCCATT
GTACGCACCCGCAATATCAGTTGCCTGAAGGACGGCAAAACTATTGATATGCCGATTAAGGGGCATGTCA
GCTTCCGGGGTAAAAACGGTATCAAGGGCGAAGTGGTGATGCGTAACGGCAAAATCCTCGGCTGGGCATG
GGGCGCGGGATTTGTTGACGGTATCGGTCAGGGAATGGAGCGCGCCTCCCAGCCGGCTGTCGGGCTGGGT
GCCACAGCCGCTTACGGGGCTGGTGATGTCCTGAAAATGGGTATCGGTGGCGGCGCATCGAAAGCCGCAC
AGACGCTCAGTGACTACTACATCAAACGTGCCGAACAGTATCACCCGGTGATACCGATTGGTGCGGGCAA
CGAAGTGACCGTGGTGTTCCAGGACGGCTTCCAGCTGAAAACCGTGGAAGAGATGGCGCTGGAACGCACG
CAGAGCAGAGCGGAAGAAGACAATCCGGAAAGTCCGGTTCCTGTTCCGCCATCGGCTGAAAGTCATCTTA
ACGGCTTTAATACTGACCAGATGCTGAAGCAGCTGGGCAACCTGAATCCGCAGCAGTTTATGTCCGGCAG
CCAGGGAGGGGGCAACGATGGCAAATAA
 Primer design