SecReT4
Protein ID: 169546524
T4SS name [ID]Tra_F [97]
Gene symbol-
Locus tagpVM01_p114
StrainEscherichia coli plasmid pVM01 (NC_010409)
Repliconplasmid pVM01 [GenBank: NC_010409] [Browse all T4SS(s) in this replicon]
Location [Strand]122965..123693 [-]
Productconjugal transfer protein TraK
Component typeTraK_F
UniProt IDB1P7T7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 7.9e-70, Aligned region: 12..235
Protein Sequence: 242 a.a.     [Download]
>gi|169546524|ref|YP_001711963.1| conjugal transfer protein TraK [Escherichia coli]
MRKNNTAIIFGSLFFSCSVMAANGTLAPTVVPMVNGGQASIAISNTSPNLFTVPGDRIIAVNSLDGALTN
NEQTASGGVVVATVNKKPFTFILETERGLNLSIQAVPREGAGRTIQLVSDLRGTGEEAGAWETSTPYESL
LVTISQAVRGGKLPAGWYQVPVTKETLKAPAGLSSVADAVWMGNHLKMVRFTVENKTLSALNIRESDFWQ
PGTRAVMFSQPASQLLAGARMDVYVIRDGEGN
 
Nucleotide Sequence: 729 bp     [Download]
>gi|169546410|ref|NC_010409.1|:c123693-122965 Escherichia coli plasmid pVM01, complete sequence
ATGAGAAAAAATAATACGGCAATAATATTCGGCAGCCTGTTTTTTTCCTGCAGCGTGATGGCCGCAAACG
GTACGCTGGCCCCCACCGTGGTGCCAATGGTGAACGGTGGTCAGGCCAGTATTGCCATCAGCAATACCAG
CCCGAATCTGTTTACCGTTCCCGGTGACCGGATTATCGCCGTGAACAGTCTGGATGGTGCCCTGACCAAT
AATGAGCAGACCGCCTCCGGCGGTGTGGTGGTGGCCACCGTCAACAAAAAGCCCTTTACGTTCATTCTGG
AAACAGAACGTGGTCTGAATCTTTCCATTCAGGCCGTTCCCCGTGAAGGCGCGGGGCGTACCATTCAGCT
GGTCAGTGACCTGCGCGGAACCGGAGAAGAAGCCGGTGCGTGGGAAACGTCCACGCCTTACGAATCCCTG
CTTGTGACCATCAGCCAGGCCGTCCGTGGCGGAAAATTACCCGCTGGCTGGTATCAGGTTCCTGTGACAA
AGGAAACCCTGAAGGCCCCTGCGGGTCTGTCTTCAGTGGCAGATGCAGTATGGATGGGGAATCACCTGAA
GATGGTCCGCTTTACCGTGGAAAATAAAACACTGTCTGCCCTGAATATCCGGGAAAGTGATTTCTGGCAG
CCGGGAACCCGTGCCGTGATGTTCAGCCAGCCTGCCAGCCAGTTACTGGCAGGTGCGCGCATGGATGTGT
ATGTCATCCGTGACGGGGAGGGCAACTGA
 Primer design