SecReT4
Protein ID: 169546525
T4SS name [ID]Tra_F [97]
Gene symbol-
Locus tagpVM01_p115
StrainEscherichia coli plasmid pVM01 (NC_010409)
Repliconplasmid pVM01 [GenBank: NC_010409] [Browse all T4SS(s) in this replicon]
Location [Strand]123680..124246 [-]
Productconjugal transfer pilus assembly protein TraE
Component typeTraE_F
UniProt IDQ7B3W6, B7LWZ3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 8.6e-74, Aligned region: 1..187
Protein Sequence: 188 a.a.     [Download]
>gi|169546525|ref|YP_001711964.1| conjugal transfer pilus assembly protein TraE [Escherichia coli]
MEHGARLSTSRVMAIAFIFMSVLIVLSLSVNVIQGVNNYRLQNEQRTAVTPMAFNAPFAVSQNSADASYL
QQMALSFIALRLNVSSETVDASHQALLQYIRPGAQNQMKVILAEEAKRIKNDNVNSAFFQTSVRVWPQYG
RVEIRGVLKTWIGDSKPFTDIKHYILILKRENGVTWLDNFGETDDEKK
 
Nucleotide Sequence: 567 bp     [Download]
>gi|169546410|ref|NC_010409.1|:c124246-123680 Escherichia coli plasmid pVM01, complete sequence
ATGGAACACGGTGCCCGTTTAAGTACCAGTCGTGTAATGGCCATCGCCTTTATATTTATGTCAGTGCTTA
TTGTTCTCAGCCTCTCTGTTAACGTCATTCAGGGGGTGAATAACTACCGTCTTCAGAATGAGCAACGCAC
TGCCGTGACGCCAATGGCATTTAATGCCCCCTTTGCCGTGTCGCAGAACAGTGCCGATGCCTCTTATTTA
CAGCAGATGGCGCTGTCATTTATTGCCCTCCGTCTGAATGTTTCATCAGAAACCGTCGATGCCTCACATC
AGGCGCTTCTGCAATATATCCGCCCGGGCGCACAGAACCAGATGAAAGTTATTCTGGCTGAAGAAGCGAA
GCGTATTAAAAACGATAACGTGAACTCAGCCTTTTTCCAGACCAGTGTTCGTGTCTGGCCTCAGTATGGC
CGTGTGGAAATTCGTGGTGTGCTTAAAACCTGGATTGGTGATTCAAAACCTTTCACTGATATCAAACATT
ACATCCTTATTCTGAAACGGGAAAACGGGGTGACCTGGCTGGATAATTTCGGGGAAACAGACGATGAGAA
AAAATAA
 Primer design