SecReT4
Protein ID: 169546527
T4SS name [ID]Tra_F [97]
Gene symbol-
Locus tagpVM01_p117
StrainEscherichia coli plasmid pVM01 (NC_010409)
Repliconplasmid pVM01 [GenBank: NC_010409] [Browse all T4SS(s) in this replicon]
Location [Strand]124594..124953 [-]
Productconjugal transfer pilin subunit TraA
Component typeTraA_F
UniProt IDB1P7U0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraA [PF05513], Evalue: 9.5e-61, Aligned region: 1..118
Protein Sequence: 119 a.a.     [Download]
>gi|169546527|ref|YP_001711966.1| conjugal transfer pilin subunit TraA [Escherichia coli]
MNAVLSVQGASVPVKKKSFFSKFTRLNMLRLARAVIPAAVLMMFFPQLAMAAQGQDLMASGNTTVKATFG
KDSSVVKWVVLAEVLVGAVMYMMTKNVKFLAGFAIISVFIAVGMAVVGL
 
Nucleotide Sequence: 360 bp     [Download]
>gi|169546410|ref|NC_010409.1|:c124953-124594 Escherichia coli plasmid pVM01, complete sequence
ATGAATGCTGTTTTAAGTGTTCAGGGTGCTTCTGTGCCCGTCAAAAAGAAGTCGTTTTTTTCTAAATTCA
CTCGTCTGAATATGCTTCGCCTGGCTCGCGCTGTGATCCCGGCTGCTGTTCTGATGATGTTCTTCCCGCA
ACTGGCAATGGCAGCACAGGGCCAGGACCTGATGGCAAGCGGTAACACCACGGTTAAGGCGACCTTCGGT
AAGGACTCCAGTGTTGTTAAATGGGTCGTTCTGGCTGAAGTTCTGGTCGGTGCGGTCATGTACATGATGA
CCAAAAACGTCAAGTTCCTGGCCGGTTTTGCCATCATCTCTGTATTTATTGCTGTGGGTATGGCCGTCGT
TGGCCTCTGA
 Primer design