SecReT4
Protein ID: 169546528
T4SS name [ID]Tra_F [97]
Gene symbol-
Locus tagpVM01_p118
StrainEscherichia coli plasmid pVM01 (NC_010409)
Repliconplasmid pVM01 [GenBank: NC_010409] [Browse all T4SS(s) in this replicon]
Location [Strand]124986..125345 [-]
Productconjugal transfer protein TraY
Component typeTraY_F
UniProt IDB1P7U1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraY [PF05509], Evalue: 3e-38, Aligned region: 3..46
TraY [PF05509], Evalue: 3e-38, Aligned region: 58..105
Protein Sequence: 119 a.a.     [Download]
>gi|169546528|ref|YP_001711967.1| conjugal transfer protein TraY [Escherichia coli]
MVKLKLPVDVESLLIEASNRSGRSRSFEAVIRLKDHLHRYPKFNRAGNIYGKSLVKYLTMRLDDETNQLL
IAAKNRSGWCKTDEAADRVIDHLIKFPDFYNSEIFREADKEEDITFNTL
 
Nucleotide Sequence: 360 bp     [Download]
>gi|169546410|ref|NC_010409.1|:c125345-124986 Escherichia coli plasmid pVM01, complete sequence
ATGGTAAAACTAAAATTACCTGTAGATGTGGAAAGTCTATTAATTGAGGCAAGTAACAGAAGCGGAAGAA
GTCGATCGTTTGAGGCAGTAATAAGACTTAAAGATCATCTTCACCGCTATCCAAAGTTTAACAGGGCAGG
GAATATCTATGGTAAGTCGCTGGTTAAGTATCTGACAATGCGTCTGGATGATGAAACTAACCAGCTACTT
ATTGCAGCCAAAAATCGTAGTGGATGGTGTAAAACAGATGAGGCTGCAGACAGAGTTATTGATCATTTGA
TCAAGTTTCCTGATTTTTATAACTCGGAGATATTCAGGGAGGCAGATAAAGAGGAAGATATAACATTTAA
TACACTCTAG
 Primer design