SecReT4
Protein ID: 169546530
T4SS name [ID]Tra_F [97]
Gene symbol-
Locus tagpVM01_p120
StrainEscherichia coli plasmid pVM01 (NC_010409)
Repliconplasmid pVM01 [GenBank: NC_010409] [Browse all T4SS(s) in this replicon]
Location [Strand]126356..126739 [-]
Productconjugal transfer protein TraM
Component typeTraM_F
UniProt IDQ84A34, B7LI62
KEGG IDecz:pECS88_0063
PDB IDNA
Domain hit(s) vs Pfam Tra_M [PF05261], Evalue: 1e-59, Aligned region: 1..127
Protein Sequence: 127 a.a.     [Download]
>gi|169546530|ref|YP_001711969.1| conjugal transfer protein TraM [Escherichia coli]
MAKVNLYISNDAYEKINAIIEKRRQEGAREKDVSFSATASMLLELGLRVHEAQMERKESAFNQTEFNKLL
LECVVKTQSSVAKILGIESLSPHVSGNPKFEYANMVEDIREKVSSEMERFFPKNDDE
 
Nucleotide Sequence: 384 bp     [Download]
>gi|169546410|ref|NC_010409.1|:c126739-126356 Escherichia coli plasmid pVM01, complete sequence
ATGGCTAAGGTGAACCTGTATATCAGCAATGATGCCTATGAAAAAATAAATGCGATTATTGAGAAGCGTC
GACAGGAAGGGGCAAGGGAAAAAGATGTCAGTTTTTCAGCAACAGCTTCAATGCTTCTTGAACTGGGGCT
TCGTGTACATGAGGCTCAGATGGAGCGTAAAGAGTCTGCATTTAATCAGACTGAGTTTAATAAATTGCTT
CTTGAATGCGTTGTAAAAACACAATCATCAGTAGCGAAAATTTTGGGTATTGAGTCTCTCAGTCCTCATG
TCTCCGGAAATCCAAAGTTTGAATATGCCAATATGGTTGAAGATATCAGGGAGAAGGTATCATCTGAGAT
GGAACGATTTTTTCCAAAAAATGATGATGAATAA
 Primer design