SecReT4
Protein ID: 169546531
T4SS name [ID]Tra_F [97]
Gene symbol-
Locus tagpVM01_p121
StrainEscherichia coli plasmid pVM01 (NC_010409)
Repliconplasmid pVM01 [GenBank: NC_010409] [Browse all T4SS(s) in this replicon]
Location [Strand]127153..127662 [+]
Productlytic transglycosylase
Component typeOrf169_F
UniProt IDB1P7U4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 169 a.a.     [Download]
>gi|169546531|ref|YP_001711970.1| lytic transglycosylase [Escherichia coli]
MKKWMLAICLMFINEICHATDCFDLAGRDYKIDPDLLRAISWKESRYRVNAIGINPVTGYGSGLMQVDSQ
HFNELARYGIKPEHLTTDPCMNIYTGAYYLAIAFKKWGVTWEAVGAYNAGFRKSERQNQRRLAYASEVYR
IYTGIKSSKGIRLPATKKSLPEINSVQNN
 
Nucleotide Sequence: 510 bp     [Download]
>gi|169546410|ref|NC_010409.1|:127153-127662 Escherichia coli plasmid pVM01, complete sequence
ATGAAAAAATGGATGTTAGCCATCTGCCTGATGTTTATAAATGAGATCTGCCATGCCACTGATTGCTTTG
ATCTTGCAGGCCGGGATTACAAAATAGATCCTGATTTACTGAGAGCAATATCATGGAAAGAATCCCGTTA
CCGGGTTAATGCCATCGGTATTAATCCGGTAACGGGATATGGCAGCGGACTGATGCAGGTAGATTCCCAG
CATTTTAACGAACTGGCCCGCTACGGAATTAAGCCAGAACATCTGACAACAGATCCCTGCATGAACATTT
ATACCGGTGCTTATTATCTGGCAATAGCATTTAAAAAATGGGGCGTCACCTGGGAGGCCGTTGGTGCATA
CAATGCAGGATTCAGGAAATCCGAACGCCAGAACCAGAGACGTCTTGCCTACGCATCAGAGGTTTACCGG
ATTTATACCGGGATAAAAAGCAGTAAAGGTATCCGGCTTCCGGCCACGAAGAAATCACTTCCGGAAATTA
ACAGCGTGCAGAACAATTAA
 Primer design