SecReT4
Protein ID: 169646987
T4SS name [ID]VirB [456]
Gene symboltaxB
Locus tagpOU1114_013
StrainSalmonella enterica subsp. enterica serovar Dublin plasmid pOU1114 (NC_010421)
Repliconplasmid pOU1114 [GenBank: NC_010421] [Browse all T4SS(s) in this replicon]
Location [Strand]9190..11031 [-]
ProductTaxB
Component typeVirD4
UniProt IDB1MU10
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1e-143, Aligned region: 104..573
TraG-D_C [PF12696], Evalue: 3.6e-25, Aligned region: 418..536
TrwB_AAD_bind [PF10412], Evalue: 6.5e-19, Aligned region: 333..550
Protein Sequence: 613 a.a.     [Download]
>gi|169646987|ref|YP_001716075.1| TaxB [Salmonella enterica subsp. enterica serovar Dublin]
MIMSLKLPDKGQWAFIGLVMCLVTYYTGSVAVYFLNGKTPLYIWKNFDSMLLWRIITESNIRTDIRLTAI
PSLLSGMVSSLIVPVFIIWQLNKTDVALYGDAKFASDNDLRKSKLLKWEKENDTDILVGAYKGKYLWYTA
PDFVSLGAGTRAGKGAAIGIPNLLVRKHSLIALDPKQELWKITSKVREILLGNKVYLLDPFNSKTHQFNP
LFYIDLKAESGAKDLLKLIEILFPSYGMTGAEAHFNNLAGQYWTGLAKLLHFFINYEPSWLNEFGLKPVF
SIGSVVDLYSNIDRELVLSKREELEGTNGLDENALYHLRDALTKIREYHETEDEQRSSIDGSFRKKMSLF
YLPTVRKCTDGNDFDLRQLRREDITVYVGVNAEDISLAYDFLNLFFNFVVEVTLRENPDFDPTLKHDCLM
FLDEFPSIGYMPIIKKGSGYIAGFKLKLLTIYQNISQLNEIYGIEGAKTLMSAHPCRIIYAVSEEDDAAK
ISEKLGYITTTSKSTSKSRGRSTSQGESESEARRALVLPQELGTLDFKEEFIILKGENPVKAEKALYYLD
PYFMDRLMKVSPKLASLTMELNKTEKIFGVKGLKYPSKEKMLSVGELESEVLL
 
Nucleotide Sequence: 1842 bp     [Download]
>gi|169646974|ref|NC_010421.1|:c11031-9190 Salmonella enterica subsp. enterica serovar Dublin plasmid pOU1114, complete sequence
GTGATTATGTCTTTAAAACTCCCAGATAAAGGCCAGTGGGCTTTTATCGGTCTGGTTATGTGTCTCGTGA
CATATTATACTGGTTCTGTTGCTGTTTACTTCCTGAACGGAAAAACGCCGCTTTATATATGGAAAAATTT
TGATTCCATGCTCCTGTGGCGAATAATAACAGAGAGTAATATACGGACAGATATCAGGTTAACCGCTATC
CCCTCTCTTTTATCAGGTATGGTTTCGTCTCTCATCGTGCCTGTTTTTATTATCTGGCAACTGAATAAAA
CAGATGTTGCTCTTTATGGTGACGCGAAGTTTGCCAGTGATAATGATTTAAGAAAATCGAAACTTCTGAA
ATGGGAGAAAGAAAACGATACTGATATTCTCGTCGGGGCATATAAAGGTAAATACCTGTGGTATACCGCA
CCAGATTTTGTATCACTTGGTGCAGGAACCCGCGCAGGTAAAGGTGCCGCCATTGGTATCCCTAATCTTC
TGGTCAGAAAACACTCTCTGATTGCGTTAGATCCAAAACAGGAATTGTGGAAAATCACCAGTAAGGTGCG
TGAAATACTGCTGGGTAATAAAGTTTATCTGCTCGACCCTTTCAACAGTAAAACACACCAGTTTAATCCC
CTTTTCTATATTGATTTAAAAGCGGAGAGTGGGGCTAAGGATCTGCTTAAACTGATTGAAATTCTGTTTC
CGTCTTATGGCATGACAGGGGCAGAAGCGCACTTTAATAATCTTGCGGGTCAATACTGGACAGGACTGGC
TAAGTTGCTTCATTTCTTTATTAACTATGAGCCGTCCTGGCTTAATGAGTTCGGGCTTAAACCCGTTTTC
TCAATCGGTTCTGTCGTCGACTTGTACAGCAATATTGACCGGGAACTGGTACTCAGTAAGCGGGAAGAAC
TGGAGGGAACAAACGGGCTTGATGAAAACGCGTTGTATCATTTGCGCGATGCCCTGACCAAAATCAGGGA
ATATCACGAAACGGAAGATGAACAGCGTTCAAGCATTGATGGTTCTTTCCGTAAGAAAATGAGCCTGTTT
TATCTCCCAACCGTTCGTAAATGTACTGATGGTAATGATTTCGATCTCCGTCAGTTGCGACGGGAAGATA
TCACTGTTTATGTCGGTGTTAATGCGGAAGATATATCACTGGCTTACGATTTTCTGAACCTGTTTTTCAA
CTTCGTTGTTGAAGTGACATTGCGTGAAAATCCTGATTTTGATCCCACCCTGAAACATGACTGTCTGATG
TTTCTTGATGAGTTCCCTTCGATTGGTTATATGCCAATTATTAAAAAGGGGTCAGGGTATATTGCAGGTT
TTAAACTTAAGCTTCTGACAATTTATCAGAATATCAGTCAGCTAAATGAAATCTATGGTATTGAGGGAGC
CAAAACGCTGATGAGTGCTCATCCATGCCGTATTATCTATGCTGTCAGCGAAGAGGACGATGCCGCGAAG
ATATCAGAAAAACTTGGGTATATTACTACTACCTCAAAGAGCACAAGCAAGAGCCGGGGACGCTCAACAT
CACAGGGCGAATCAGAAAGTGAAGCCCGAAGAGCTCTGGTGCTTCCACAGGAGCTGGGAACGCTGGACTT
TAAAGAAGAGTTTATCATCCTGAAGGGAGAGAACCCTGTTAAAGCAGAAAAGGCACTTTATTACCTTGAT
CCGTATTTTATGGACAGATTAATGAAGGTGAGTCCCAAACTGGCATCATTGACGATGGAACTAAATAAGA
CGGAAAAAATATTTGGTGTGAAAGGGCTTAAATATCCGTCAAAAGAAAAAATGCTCTCCGTAGGAGAGCT
GGAGTCTGAGGTTTTGCTATGA
 Primer design