SecReT4
Protein ID: 169646988
T4SS name [ID]VirB [456]
Gene symbolpilX11
Locus tagpOU1114_014
StrainSalmonella enterica subsp. enterica serovar Dublin plasmid pOU1114 (NC_010421)
Repliconplasmid pOU1114 [GenBank: NC_010421] [Browse all T4SS(s) in this replicon]
Location [Strand]11028..12059 [-]
ProductVirB11-like ATPase
Component typeVirB11
UniProt IDB1MU11
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 2.9e-51, Aligned region: 25..312
Protein Sequence: 343 a.a.     [Download]
>gi|169646988|ref|YP_001716076.1| VirB11-like ATPase [Salmonella enterica subsp. enterica serovar Dublin]
MNNENRHLIYDVVNDYFYHWLNEIDGVTEIAVNRPGEIFIKVRGKWQWYEQKMSYSDCLSFASTLADFHD
GGSVTPEYPLRSATLPGGERVQVVIPPATEKDTVSITIRKPSGIFISHDKFIKQGFYSRVGGLSGDSIME
DNISALITSEYFERVIPESLSQGKTIVFCGGTGSGKTTFANACLEYIPHHLRCISIEDTDEAKFRFHKNH
VKLYYPAEGESKVITSASLLRSCFRMNPDRILMTEIRGAEAWDFLKASSSGHAGNITTVHESSPESAVLG
IVQRCYMNPECQNLPFNVILRRVLSNIDIIMSIKYLDDEDFRFASGIYYKQLHFDDYFRKLKE
 
Nucleotide Sequence: 1032 bp     [Download]
>gi|169646974|ref|NC_010421.1|:c12059-11028 Salmonella enterica subsp. enterica serovar Dublin plasmid pOU1114, complete sequence
GTGAATAACGAAAACAGACATCTGATTTATGATGTGGTCAACGATTATTTTTATCACTGGCTGAATGAGA
TTGATGGTGTCACGGAAATCGCTGTTAACCGACCAGGAGAAATATTTATAAAGGTCAGGGGAAAGTGGCA
ATGGTATGAACAAAAGATGAGTTACAGTGATTGTCTTTCTTTTGCATCCACACTGGCTGATTTTCATGAC
GGTGGTTCTGTGACTCCTGAATATCCCCTGCGTTCCGCCACGCTTCCGGGTGGAGAACGTGTTCAGGTTG
TGATCCCACCGGCAACAGAAAAAGATACTGTTTCTATAACAATCCGTAAGCCGTCAGGTATTTTTATCAG
TCATGACAAATTTATAAAACAGGGGTTTTATTCACGCGTCGGTGGTTTAAGTGGTGATTCCATTATGGAA
GATAATATTTCTGCTTTAATCACTTCCGAATATTTTGAACGGGTTATACCTGAATCACTGAGTCAGGGGA
AAACGATAGTTTTCTGTGGAGGGACGGGGTCTGGTAAAACTACCTTTGCAAATGCCTGTCTGGAATATAT
ACCGCATCATCTGCGGTGTATTTCTATTGAAGATACTGATGAGGCAAAATTCAGATTCCATAAAAACCAT
GTAAAACTTTACTATCCGGCAGAGGGTGAGAGTAAGGTTATTACCTCAGCGAGTCTTCTGCGTTCCTGTT
TTCGTATGAATCCGGACAGGATTCTGATGACAGAAATCAGGGGGGCTGAGGCATGGGATTTTCTGAAAGC
ATCGAGTTCAGGCCATGCAGGAAACATCACCACCGTTCACGAAAGTAGTCCTGAATCTGCCGTGCTTGGG
ATTGTCCAGCGATGTTATATGAATCCTGAATGTCAGAATCTACCATTCAATGTCATTTTAAGACGTGTAC
TGAGTAATATTGATATTATCATGAGTATTAAATACCTTGATGATGAAGATTTTCGGTTCGCTTCCGGTAT
TTACTACAAACAACTTCATTTTGATGACTATTTCAGAAAACTGAAGGAGTGA
 Primer design