SecReT4
Protein ID: 169646989
T4SS name [ID]VirB [456]
Gene symbolpilX10
Locus tagpOU1114_015
StrainSalmonella enterica subsp. enterica serovar Dublin plasmid pOU1114 (NC_010421)
Repliconplasmid pOU1114 [GenBank: NC_010421] [Browse all T4SS(s) in this replicon]
Location [Strand]12061..13266 [-]
Productconjugation TrbI-like protein
Component typeVirB10
UniProt IDB1MU12
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1e-48, Aligned region: 208..390
Protein Sequence: 401 a.a.     [Download]
>gi|169646989|ref|YP_001716077.1| conjugation TrbI-like protein [Salmonella enterica subsp. enterica serovar Dublin]
MTEQENKIPTATEIEQQLRERRQKELEQAGKTPEEEPGKPALQLGIEKLKKSRKGMIILVVGFLLLAAGV
SVYYIPSIIRSVSSGDEKPASQPLATGAAKRQTGLSEDIDPFNTAQKKTEKPEEEKVISSEKTEPPENKQ
QSFSRALDVSLDGSQAGNSSSSAGTSVSHTAASEPESDKKDEAKATAQATESAPLAKITKLPYDPNLFIP
EGTSIPCSLDRRFVSDLAGKLECTVNSDIYSASGNVKLIERGTAAKLMYKAGSLNHGQGRVFVMAYKLRT
RSKPFIDIPLVDSQAAGALGEAGASGWIDTHFSERFLGAMMVGMIPDLSQAASGIAQNNRDSQTDYTANS
RQAFADIAREAFSNSVNIPPTLYKNQGEIITLIVGQDLDFSGIYKLKMKGG
 
Nucleotide Sequence: 1206 bp     [Download]
>gi|169646974|ref|NC_010421.1|:c13266-12061 Salmonella enterica subsp. enterica serovar Dublin plasmid pOU1114, complete sequence
GTGACTGAACAGGAAAATAAAATCCCGACTGCAACCGAAATTGAACAGCAGCTACGGGAACGCAGACAGA
AAGAACTGGAACAGGCCGGGAAGACTCCGGAAGAAGAGCCTGGCAAGCCAGCATTGCAGCTTGGTATTGA
AAAACTTAAAAAGTCACGTAAAGGAATGATTATCCTTGTCGTGGGTTTTCTTCTGCTTGCTGCCGGTGTT
TCTGTTTATTATATCCCGTCCATTATCCGTTCTGTGTCGTCAGGGGATGAGAAACCCGCAAGTCAGCCGC
TTGCAACCGGAGCGGCTAAACGTCAGACCGGACTGAGCGAAGATATCGATCCTTTTAATACCGCACAGAA
AAAAACAGAGAAACCAGAGGAAGAAAAAGTCATTTCTTCTGAAAAGACTGAACCGCCGGAAAATAAACAG
CAGAGCTTCAGCCGTGCACTTGATGTTTCTCTTGATGGCAGCCAGGCAGGAAACAGCAGCAGTTCAGCGG
GAACGTCAGTTTCACATACTGCGGCCAGTGAGCCAGAAAGCGATAAAAAGGATGAAGCAAAAGCAACCGC
ACAGGCTACAGAATCTGCGCCACTGGCGAAAATAACGAAACTTCCATATGACCCAAATTTGTTTATCCCG
GAAGGGACATCAATTCCCTGTTCACTGGACAGGCGTTTTGTTTCTGACCTGGCGGGGAAACTGGAATGTA
CGGTCAACAGCGATATATACAGCGCCAGCGGTAATGTAAAACTTATCGAAAGAGGAACCGCCGCAAAACT
GATGTATAAGGCCGGGTCTTTAAATCATGGACAAGGGCGTGTGTTTGTTATGGCTTACAAGCTACGTACT
CGCAGTAAGCCTTTTATTGATATTCCCCTGGTTGACTCACAGGCGGCTGGCGCGTTAGGCGAAGCCGGTG
CTTCTGGTTGGATTGACACTCATTTCAGTGAACGTTTTCTTGGTGCAATGATGGTCGGGATGATACCGGA
TTTAAGTCAGGCCGCCAGTGGTATTGCACAGAACAACAGGGACAGCCAGACCGACTATACGGCAAACAGT
CGCCAGGCTTTTGCTGATATAGCACGCGAAGCATTTTCTAATAGTGTGAATATTCCGCCAACGCTTTATA
AAAATCAGGGCGAAATTATTACTCTGATTGTCGGTCAGGATCTGGATTTTTCAGGTATTTATAAACTGAA
AATGAAAGGGGGTTAA
 Primer design