SecReT4
Protein ID: 169646990
T4SS name [ID]VirB [456]
Gene symbolpilX9
Locus tagpOU1114_016
StrainSalmonella enterica subsp. enterica serovar Dublin plasmid pOU1114 (NC_010421)
Repliconplasmid pOU1114 [GenBank: NC_010421] [Browse all T4SS(s) in this replicon]
Location [Strand]13430..14182 [-]
Productconjugal transfer protein
Component typeVirB9
UniProt IDB1MU13
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.2e-40, Aligned region: 31..241
Protein Sequence: 250 a.a.     [Download]
>gi|169646990|ref|YP_001716078.1| conjugal transfer protein [Salmonella enterica subsp. enterica serovar Dublin]
MKMNKGALIMALLMAAHVCHAAVLPSGSRFDPRNQIVSYNPNNTTIINSAVGYTTTLVFDEDETVISART
GFPQGWAVNKEDNLVYLEVRPVKQTVQKNNMDENGNTSSESVSVALDPENELERWRTNLFVRTTKRNYSM
ELNARTFRQPEKIAFVVNYQYPQERRKEQAEIEKKRTEALARRQEEQAINRSLENAKSPRNWQYWKRVAE
GSQDISPDYAYDDGRYTWFGFSPLKKIPSGTVCRRLLPIL
 
Nucleotide Sequence: 753 bp     [Download]
>gi|169646974|ref|NC_010421.1|:c14182-13430 Salmonella enterica subsp. enterica serovar Dublin plasmid pOU1114, complete sequence
ATGAAAATGAATAAAGGAGCGTTAATTATGGCGCTTCTGATGGCGGCGCACGTCTGTCATGCAGCTGTTC
TTCCTTCAGGCAGTCGCTTTGACCCACGCAATCAGATAGTCAGTTATAACCCCAATAATACCACCATAAT
TAACAGTGCCGTTGGATACACCACCACACTGGTATTTGATGAAGATGAAACAGTTATCAGTGCCAGAACT
GGTTTTCCGCAGGGATGGGCGGTTAATAAAGAAGATAACCTGGTATACCTGGAAGTTCGTCCTGTTAAAC
AGACTGTTCAGAAAAATAATATGGATGAAAACGGTAATACCTCTTCTGAATCCGTCAGTGTTGCTCTTGA
CCCGGAAAATGAGCTTGAACGCTGGCGAACGAATTTGTTTGTTCGCACCACGAAGCGTAATTACAGCATG
GAGCTGAACGCTCGGACGTTCCGGCAGCCGGAGAAAATTGCGTTTGTGGTGAATTACCAGTATCCGCAGG
AACGCCGGAAGGAACAGGCCGAAATTGAGAAGAAACGCACAGAGGCTCTTGCCAGACGCCAGGAGGAGCA
GGCAATCAACCGTTCCTTGGAAAATGCGAAATCGCCCCGTAACTGGCAGTACTGGAAGCGGGTTGCTGAA
GGCAGCCAGGATATCAGCCCTGATTATGCATATGACGATGGCCGTTATACCTGGTTCGGCTTCAGTCCGT
TAAAGAAAATTCCCAGCGGAACGGTATGCAGGAGACTCTTACCAATCCTGTGA
 Primer design