SecReT4
Protein ID: 169646991
T4SS name [ID]VirB [456]
Gene symbolpilX8
Locus tagpOU1114_017
StrainSalmonella enterica subsp. enterica serovar Dublin plasmid pOU1114 (NC_010421)
Repliconplasmid pOU1114 [GenBank: NC_010421] [Browse all T4SS(s) in this replicon]
Location [Strand]14187..14900 [-]
Producttype IV secretion system VirB8 component
Component typeVirB8
UniProt IDB1MU14
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.9e-47, Aligned region: 19..234
Protein Sequence: 237 a.a.     [Download]
>gi|169646991|ref|YP_001716079.1| type IV secretion system VirB8 component [Salmonella enterica subsp. enterica serovar Dublin]
MEFKLPGFKNKKDVTDSSVSFEEKNIALQERMNRIYKFGGIGGMLIGGLSLLALNAALPLKTTVVDAYLI
DKVTGVAERLTSVKKENLSENEAIARYFITQYIKHREGYNFFSLQHDYDYVMAYSAENVAADYNALFNSE
QAPKLVYNKAEKTAMVQDNPSVIISPSSRADDKDIGAYIRFRLTIRDVATGQTRQEFWNVRLTYRIEPQV
EMVSGERNNNPLKFVVTSYVRDKEARG
 
Nucleotide Sequence: 714 bp     [Download]
>gi|169646974|ref|NC_010421.1|:c14900-14187 Salmonella enterica subsp. enterica serovar Dublin plasmid pOU1114, complete sequence
ATGGAATTTAAACTTCCCGGATTTAAAAATAAAAAAGACGTTACTGACTCATCAGTTTCATTTGAAGAAA
AAAACATTGCACTACAGGAGAGAATGAATCGTATTTATAAATTCGGTGGTATCGGAGGCATGTTAATTGG
TGGGCTGTCTTTACTTGCATTAAATGCAGCATTACCACTGAAAACAACAGTTGTTGATGCCTACCTTATC
GATAAGGTTACAGGTGTGGCTGAACGTCTGACTTCTGTTAAAAAAGAAAATCTTTCTGAAAACGAAGCCA
TTGCCCGATATTTTATCACCCAGTATATAAAACATCGTGAAGGTTATAATTTTTTCAGTCTCCAGCATGA
TTATGATTATGTAATGGCTTACAGCGCGGAGAATGTCGCGGCAGATTATAACGCATTATTTAACAGTGAA
CAGGCACCAAAACTTGTTTATAACAAAGCAGAAAAAACGGCAATGGTTCAGGATAATCCATCTGTCATAA
TTTCACCTTCGTCACGGGCAGATGATAAAGATATCGGTGCGTATATTCGTTTTCGTCTGACCATCAGGGA
TGTTGCTACCGGACAAACCCGCCAGGAGTTCTGGAATGTTCGCCTGACTTATCGTATCGAACCGCAGGTT
GAAATGGTGTCAGGGGAACGTAATAACAATCCTCTTAAATTCGTTGTAACAAGCTACGTTCGCGATAAAG
AAGCCAGAGGTTAA
 Primer design