SecReT4
Protein ID: 169646992
T4SS name [ID]VirB [456]
Gene symbolpilX7
Locus tagpOU1114_018
StrainSalmonella enterica subsp. enterica serovar Dublin plasmid pOU1114 (NC_010421)
Repliconplasmid pOU1114 [GenBank: NC_010421] [Browse all T4SS(s) in this replicon]
Location [Strand]14890..15018 [-]
ProductPilx7 protein
Component typeVirB7
UniProt IDB1MU15
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 42 a.a.     [Download]
>gi|169646992|ref|YP_001716080.1| Pilx7 protein [Salmonella enterica subsp. enterica serovar Dublin]
MKLLIVAFVTLCLAGCQASHKLPPVSGKSEPVNSAEVMQNGI
 
Nucleotide Sequence: 129 bp     [Download]
>gi|169646974|ref|NC_010421.1|:c15018-14890 Salmonella enterica subsp. enterica serovar Dublin plasmid pOU1114, complete sequence
ATGAAACTACTTATTGTGGCTTTCGTGACGCTTTGTCTCGCTGGTTGTCAGGCGTCACATAAACTACCGC
CCGTTTCCGGGAAAAGCGAACCTGTTAATTCTGCTGAGGTAATGCAAAATGGAATTTAA
 Primer design