SecReT4
Protein ID: 169646993
T4SS name [ID]VirB [456]
Gene symbolpilX5
Locus tagpOU1114_019
StrainSalmonella enterica subsp. enterica serovar Dublin plasmid pOU1114 (NC_010421)
Repliconplasmid pOU1114 [GenBank: NC_010421] [Browse all T4SS(s) in this replicon]
Location [Strand]16572..17330 [-]
ProductPilx5 protein
Component typeVirB5
UniProt IDB1MU16
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 2.2e-23, Aligned region: 22..215
Protein Sequence: 252 a.a.     [Download]
>gi|169646993|ref|YP_001716081.1| Pilx5 protein [Salmonella enterica subsp. enterica serovar Dublin]
MKKQIMAAFVASLIVISGAQAGIPVAIDANPEWAIEAGRWTERLKQWAETVKHYENQINAYKQELLSKTG
IRDVQGLVQSAQSVSQELMQIYDQGNAFIDDYIKNPEGALSEQAKSLLSDYKVTDTCQNLGYSGDLVRGC
EATFLSQLASVEYGNKLESKLRQDNQTMKDLIDQVKNAKDTKATQDATNAVALEQLKFEKLKFQYQMYRD
KQRDLAEYKEKMAQAAFRKQQREAVPPSYRKAYMAMKSYEDD
 
Nucleotide Sequence: 759 bp     [Download]
>gi|169646974|ref|NC_010421.1|:c17330-16572 Salmonella enterica subsp. enterica serovar Dublin plasmid pOU1114, complete sequence
ATGAAAAAGCAAATTATGGCGGCATTCGTCGCTTCACTGATTGTTATTTCCGGCGCTCAGGCAGGGATAC
CTGTTGCCATCGACGCCAACCCTGAATGGGCGATTGAAGCTGGACGATGGACAGAACGCCTTAAGCAATG
GGCGGAAACGGTAAAACATTACGAAAATCAGATAAATGCGTACAAACAGGAGCTGCTGTCAAAAACGGGT
ATCCGTGATGTGCAGGGACTGGTGCAGTCCGCACAGTCAGTGAGTCAGGAACTGATGCAGATTTATGATC
AGGGGAATGCTTTTATTGACGATTACATTAAAAATCCTGAAGGGGCGTTATCGGAACAGGCCAAATCGTT
ATTGTCAGATTACAAAGTAACGGATACCTGCCAGAACCTGGGATATTCCGGCGACCTGGTACGGGGATGT
GAAGCGACGTTCCTTTCTCAACTGGCAAGCGTGGAATACGGTAACAAGCTGGAGAGCAAGCTTCGTCAGG
ACAACCAGACGATGAAAGACCTTATTGATCAAGTCAAAAATGCGAAGGATACGAAGGCCACGCAGGATGC
AACAAACGCTGTTGCACTTGAACAACTGAAGTTCGAGAAGCTCAAATTTCAGTATCAAATGTATCGCGAT
AAGCAGCGAGATCTTGCAGAATATAAAGAGAAGATGGCTCAGGCAGCTTTCAGAAAACAGCAACGTGAAG
CCGTGCCACCTTCTTACAGAAAAGCTTATATGGCAATGAAATCATATGAGGATGATTAA
 Primer design