SecReT4
Protein ID: 169646994
T4SS name [ID]VirB [456]
Gene symbolpilX4
Locus tagpOU1114_020
StrainSalmonella enterica subsp. enterica serovar Dublin plasmid pOU1114 (NC_010421)
Repliconplasmid pOU1114 [GenBank: NC_010421] [Browse all T4SS(s) in this replicon]
Location [Strand]17341..20094 [-]
ProductPilx4 protein
Component typeVirB4
UniProt IDB1MU17
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 5.7e-46, Aligned region: 272..474
AAA_10 [PF12846], Evalue: 5.7e-29, Aligned region: 539..825
VirB3 [PF05101], Evalue: 6.8e-22, Aligned region: 2..84
Protein Sequence: 917 a.a.     [Download]
>gi|169646994|ref|YP_001716082.1| Pilx4 protein [Salmonella enterica subsp. enterica serovar Dublin]
MSTLFKGLTRPALIRGLGVPLYPFLGMCIICVLLGVWIHEAMYALILPGWYAIRRVTQFDERFFDLLYLR
TLVKGHPLSNKRFSAVHYAGSQYNEVDISKVDNFMKLKDQSSVEELIPYSSHITDNIIVTKNRDLLATWQ
IDGAYFECVDSEDLSILTDQLNTLIRSFEGKFVTLYPHRIRCKKGVRPVFNSKIPFVNRVMNDYYESFPQ
SEFFENKLFLTICFKPFTTEDKVTHFFSRSKKQKDIFKEPVNEMNEICDRLNTYLSRFHSRRLGLYEDHG
VVYSDQLSLFQYLLSGRWQKVRVSSSPFYTYLGGKDLFFGNDAGQITASDHARYFRCIEIKDYFQETDAG
ILDALMYLPVEYVVTSSFTAMDKQSAIKALDDQIDKLEMTDDAAKSLLADLKVGLDMVSSGYISFGKSHQ
TLVVFADSPERLVKDTNIVTSTLEDLGLIVTYSTLSLGAAYFAQLPGNYTLRPRLSTLSSLNFAEMESFH
NFFSGKEKGNTWGEKLITLRGSGNDIYHLNYHMTTEHQNFFGKNPTLGHTEILGTSNVGKTVLLMTKAFA
AQQFGTPESFPANRKLKKLTTVFFDKDRAGEVGIRAMGGSYYRVKEGEPTGWNPAALPPTKRNIAFMKDL
VRLLCTLNSEPLDDYQNSLISDAVERLMQRSDRSYPISKLRPLIQEPDDTETKRHGLKARLKPWTQGEEF
GWVFDNREDTFDVDNLDVFGIDGTEFLDNKVLASAASFYLIYRVTMLADGRRLLIYMDEFWQWINNEAFR
DFVYNKLKTGRKLDMVLVVATQSPDELIKSPIAAAVREQCATHIYLANPKAKRSEYVDGLQVRELYFDKI
KAIDPLSRQFLVVKNPQRKGESDDFAAFARLELGKAAYYLPVLSASKPQLELFDEIWKEGMKPEEWLDTY
LEQANLI
 
Nucleotide Sequence: 2754 bp     [Download]
>gi|169646974|ref|NC_010421.1|:c20094-17341 Salmonella enterica subsp. enterica serovar Dublin plasmid pOU1114, complete sequence
ATGAGTACTCTTTTTAAAGGTCTTACGCGCCCTGCTTTAATAAGGGGGCTGGGCGTTCCGCTCTACCCCT
TTCTTGGAATGTGCATTATTTGTGTTCTGCTTGGTGTCTGGATTCATGAGGCTATGTATGCCCTTATTCT
TCCTGGCTGGTATGCCATCAGGCGTGTAACACAGTTTGATGAACGCTTTTTTGACCTTCTGTATCTGAGA
ACTCTTGTCAAAGGGCATCCTTTATCAAACAAGCGATTCAGCGCAGTCCATTATGCGGGGAGCCAGTACA
ATGAAGTTGATATTTCAAAAGTGGATAACTTTATGAAGCTGAAAGACCAGTCTTCTGTTGAAGAGTTAAT
TCCGTACTCTTCACATATCACTGATAATATTATCGTTACAAAAAACCGGGATTTGCTGGCAACCTGGCAG
ATAGACGGTGCTTACTTTGAGTGTGTTGATTCTGAAGATTTGTCAATTCTGACAGATCAGCTTAATACGC
TTATACGTAGCTTTGAAGGGAAATTTGTTACGCTTTATCCTCATCGTATCAGGTGTAAAAAGGGTGTCAG
ACCAGTATTTAACAGTAAAATTCCTTTTGTGAACAGAGTAATGAATGATTATTACGAGTCATTCCCTCAG
TCTGAATTTTTCGAGAATAAATTATTTCTGACGATTTGTTTTAAACCTTTTACTACGGAAGATAAAGTAA
CACATTTCTTTTCACGCAGTAAAAAACAAAAAGATATCTTTAAAGAGCCTGTTAATGAAATGAATGAAAT
TTGCGACAGGTTGAATACCTATCTGTCCCGTTTTCATTCCCGACGTCTTGGGCTTTATGAAGATCATGGG
GTTGTTTATTCAGATCAGTTATCTCTGTTCCAGTATCTGCTTTCTGGTCGATGGCAAAAGGTCAGGGTTA
GCAGTAGTCCGTTTTATACATATCTGGGAGGAAAAGACCTGTTCTTTGGTAATGATGCCGGACAAATTAC
CGCGTCAGACCATGCCCGGTATTTTCGTTGCATAGAGATTAAGGATTATTTTCAGGAGACGGATGCCGGT
ATTCTGGATGCTCTGATGTATCTCCCCGTTGAGTATGTCGTGACATCGTCCTTTACTGCGATGGATAAGC
AGTCAGCGATTAAGGCGCTGGATGATCAGATCGATAAGCTGGAAATGACAGATGATGCTGCCAAATCTTT
GCTGGCAGATCTGAAAGTCGGACTGGATATGGTTTCCAGTGGATATATTTCTTTCGGAAAATCGCATCAG
ACCCTGGTTGTCTTTGCGGATTCACCGGAGCGGCTGGTGAAAGACACCAATATCGTGACTTCCACTCTGG
AAGATTTGGGGCTGATTGTCACTTATTCAACACTGAGTCTTGGCGCAGCTTATTTTGCTCAGCTACCAGG
AAATTATACGCTTCGCCCTCGTCTGAGTACCCTCAGTAGTCTTAATTTTGCCGAAATGGAAAGTTTTCAT
AATTTCTTTTCAGGAAAAGAAAAAGGAAATACCTGGGGGGAAAAACTGATTACTCTTCGGGGGTCAGGTA
ATGATATCTACCATCTGAATTACCATATGACGACTGAACATCAGAATTTCTTCGGTAAGAACCCGACGCT
GGGGCATACCGAAATTCTCGGTACGTCTAACGTGGGTAAAACCGTATTACTGATGACAAAAGCATTTGCC
GCCCAGCAGTTCGGTACGCCGGAATCATTCCCTGCAAACAGAAAACTGAAAAAACTGACCACGGTTTTTT
TTGATAAAGACCGGGCAGGTGAAGTCGGTATACGGGCAATGGGGGGATCTTATTACCGGGTGAAGGAGGG
AGAGCCGACAGGCTGGAATCCCGCCGCACTGCCGCCAACAAAGCGTAATATCGCTTTTATGAAGGACCTG
GTGAGGCTGCTTTGTACTCTCAACAGTGAGCCGCTCGATGATTACCAGAACAGCCTGATTTCAGATGCGG
TTGAACGTCTTATGCAACGGTCAGATCGCTCTTATCCTATCAGTAAACTACGGCCTCTTATCCAGGAGCC
GGATGATACTGAAACCAAACGTCATGGACTTAAAGCCCGTCTTAAGCCGTGGACGCAGGGGGAAGAGTTT
GGCTGGGTGTTCGACAATCGGGAAGACACGTTTGATGTCGATAACCTGGATGTTTTCGGTATTGATGGAA
CGGAGTTCCTGGATAATAAGGTGCTGGCCAGTGCTGCTTCATTCTATCTCATCTATCGGGTCACCATGCT
GGCCGATGGTCGCAGGCTTCTTATCTACATGGATGAGTTCTGGCAATGGATCAATAACGAAGCGTTCAGG
GACTTTGTTTACAACAAGCTGAAAACCGGACGTAAACTCGATATGGTGCTTGTCGTAGCCACACAGTCAC
CGGATGAACTGATTAAATCACCCATTGCGGCAGCGGTTCGTGAGCAATGCGCCACTCATATCTATCTGGC
AAACCCGAAAGCCAAACGTAGTGAATATGTTGATGGTTTGCAGGTCAGGGAGCTTTATTTTGACAAAATT
AAAGCTATCGATCCGCTGTCCCGCCAGTTCCTTGTTGTTAAGAACCCACAGAGGAAAGGTGAAAGTGATG
ATTTTGCTGCTTTTGCCAGACTGGAGCTGGGAAAAGCAGCGTATTACTTACCGGTTCTCAGTGCATCAAA
ACCCCAGTTAGAACTGTTCGATGAAATCTGGAAAGAAGGAATGAAGCCGGAAGAGTGGCTTGATACCTAT
CTGGAACAGGCGAACCTGATTTGA
 Primer design