SecReT4
Protein ID: 169646995
T4SS name [ID]VirB [456]
Gene symbolpilX2
Locus tagpOU1114_021
StrainSalmonella enterica subsp. enterica serovar Dublin plasmid pOU1114 (NC_010421)
Repliconplasmid pOU1114 [GenBank: NC_010421] [Browse all T4SS(s) in this replicon]
Location [Strand]20113..20409 [-]
ProductPilx2 protein
Component typeVirB2
UniProt IDB1MU18
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.4e-21, Aligned region: 3..97
Protein Sequence: 98 a.a.     [Download]
>gi|169646995|ref|YP_001716083.1| Pilx2 protein [Salmonella enterica subsp. enterica serovar Dublin]
MLKLNLNKRYLTLSLFMAALMLCVAEPAFADDVSTKTTGFLQKIIDFLTDIRKPAITIIALVIGYIAIFS
RQHTSWIVPLVIGIIIFIVAPYIPDWLA
 
Nucleotide Sequence: 297 bp     [Download]
>gi|169646974|ref|NC_010421.1|:c20409-20113 Salmonella enterica subsp. enterica serovar Dublin plasmid pOU1114, complete sequence
ATGTTGAAATTAAATCTGAATAAACGTTATTTAACGCTTTCTCTATTTATGGCTGCGTTGATGCTTTGTG
TTGCAGAACCTGCTTTTGCGGATGATGTGTCTACGAAGACAACTGGTTTTTTACAGAAAATAATTGATTT
TTTAACGGATATTCGTAAACCTGCAATTACAATTATTGCTCTTGTTATTGGGTATATTGCGATATTTTCT
CGTCAACATACCTCATGGATAGTCCCACTTGTTATCGGAATTATCATCTTTATTGTTGCACCATATATTC
CTGACTGGCTTGCGTAA
 Primer design