SecReT4
Protein ID: 169646996
T4SS name [ID]VirB [456]
Gene symbolpilX1
Locus tagpOU1114_022
StrainSalmonella enterica subsp. enterica serovar Dublin plasmid pOU1114 (NC_010421)
Repliconplasmid pOU1114 [GenBank: NC_010421] [Browse all T4SS(s) in this replicon]
Location [Strand]20387..21034 [-]
ProductPilx1 protein
Component typeVirB1
UniProt IDB1MU19
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 2.5e-19, Aligned region: 9..139
Protein Sequence: 215 a.a.     [Download]
>gi|169646996|ref|YP_001716084.1| Pilx1 protein [Salmonella enterica subsp. enterica serovar Dublin]
MLSTSTFLALAMQCAASVHPDTTHEVARVESGFNPYAIAEIIPKVKRKTGDKGVVSYFPESKEAALKIVK
NIELRNHRYSVGLMQITSTNFAKFGTTAEKMFDPCENLKVSEKILVDCYKRGGDLVRGLSCYYSGNQEIG
VKPEPEFNNTSYVQRIGFSPPDNKKSFIVPSVKEMIKKENKTTITPEEIIIYPQYAMRGTVSNEKETKDV
EIKSE
 
Nucleotide Sequence: 648 bp     [Download]
>gi|169646974|ref|NC_010421.1|:c21034-20387 Salmonella enterica subsp. enterica serovar Dublin plasmid pOU1114, complete sequence
ATGTTATCTACTTCTACTTTTCTTGCGCTTGCCATGCAATGCGCTGCCAGCGTTCATCCCGACACAACGC
ACGAAGTCGCCAGGGTTGAATCAGGTTTTAACCCATATGCGATTGCGGAAATAATACCAAAGGTTAAACG
TAAAACTGGTGATAAAGGCGTAGTATCTTACTTTCCTGAATCAAAGGAGGCAGCACTTAAGATCGTTAAA
AACATTGAATTACGGAATCATCGTTACTCTGTAGGACTTATGCAAATAACGAGTACCAATTTTGCAAAGT
TCGGTACAACAGCAGAGAAAATGTTTGATCCATGTGAAAATCTTAAGGTATCAGAAAAAATACTGGTTGA
CTGTTATAAACGAGGTGGCGACTTAGTGCGTGGGCTGAGTTGCTATTATTCTGGCAATCAAGAAATAGGA
GTAAAGCCAGAACCTGAATTTAATAATACAAGTTATGTACAACGTATAGGATTTAGCCCTCCTGATAATA
AAAAAAGTTTTATTGTTCCCTCTGTAAAGGAAATGATTAAAAAGGAGAATAAGACGACTATCACACCTGA
AGAAATCATTATATATCCTCAATACGCCATGCGTGGCACTGTATCAAATGAAAAGGAAACAAAAGATGTT
GAAATTAAATCTGAATAA
 Primer design