SecReT4
Protein ID: 169647056
T4SS name [ID]VirB [457]
Gene symbolpilX7
Locus tagpOU1115_056
StrainSalmonella enterica subsp. enterica serovar Dublin plasmid pOU1115 (NC_010422)
Repliconplasmid pOU1115 [GenBank: NC_010422] [Browse all T4SS(s) in this replicon]
Location [Strand]46711..46839 [-]
ProductPilx7 protein
Component typeVirB7
UniProt IDB1MU15
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 42 a.a.     [Download]
>gi|169647056|ref|YP_001716164.1| Pilx7 protein [Salmonella enterica subsp. enterica serovar Dublin]
MKLLIVAFVTLCLAGCQASHKLPPVSGKSEPVNSAEVMQNGI
 
Nucleotide Sequence: 129 bp     [Download]
>gi|169647022|ref|NC_010422.1|:c46839-46711 Salmonella enterica subsp. enterica serovar Dublin plasmid pOU1115, complete sequence
ATGAAACTACTTATTGTGGCTTTCGTGACGCTTTGTCTCGCTGGTTGTCAGGCGTCACATAAACTACCGC
CCGTTTCCGGGAAAAGCGAACCTGTTAATTCTGCTGAGGTAATGCAAAATGGAATTTAA
 Primer design