SecReT4
Protein ID: 169647057
T4SS name [ID]VirB [457]
Gene symbolpilX8
Locus tagpOU1115_055
StrainSalmonella enterica subsp. enterica serovar Dublin plasmid pOU1115 (NC_010422)
Repliconplasmid pOU1115 [GenBank: NC_010422] [Browse all T4SS(s) in this replicon]
Location [Strand]46008..46721 [-]
Producttype IV secretion system VirB8 component
Component typeVirB8
UniProt IDB1MU98
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2e-47, Aligned region: 19..234
Protein Sequence: 237 a.a.     [Download]
>gi|169647057|ref|YP_001716163.1| type IV secretion system VirB8 component [Salmonella enterica subsp. enterica serovar Dublin]
MEFKLPGFKNKKDVTDSSVSFEEKNIALQERMNRIYKFGGIGGMLIGGLSLLALNAALPLKTTVVDAYLI
DKVTGVAERLTSVKKENLSENEAIARYFITQYIKHREGYNFFSLQHDYDYVMAYSAENVAADYNALFNSE
QAPKLVYNKAEKTAMVQDNPSVIISPSSRTDDKDIGAYIRFRLTIRDVATGQTRQEFWNVRLTYRIEPQV
EMVSGERNNNPLKFVVTSYVRDKEARG
 
Nucleotide Sequence: 714 bp     [Download]
>gi|169647022|ref|NC_010422.1|:c46721-46008 Salmonella enterica subsp. enterica serovar Dublin plasmid pOU1115, complete sequence
ATGGAATTTAAACTTCCCGGATTTAAAAATAAAAAAGACGTTACTGACTCATCAGTTTCGTTTGAAGAAA
AAAACATTGCACTACAGGAGAGAATGAATCGTATTTATAAATTCGGTGGTATCGGAGGCATGTTAATTGG
TGGTCTGTCTTTACTTGCATTAAATGCAGCATTACCACTGAAAACAACAGTTGTTGATGCCTACCTTATC
GATAAGGTTACAGGTGTGGCTGAACGTCTGACTTCTGTTAAAAAAGAAAATCTTTCTGAAAACGAAGCCA
TTGCCCGATATTTTATCACCCAGTATATAAAACATCGTGAAGGTTATAATTTTTTCAGTCTCCAGCATGA
TTATGATTATGTAATGGCTTACAGCGCGGAGAATGTCGCGGCAGATTATAACGCATTATTTAACAGTGAA
CAGGCACCAAAACTTGTTTATAACAAAGCAGAAAAAACGGCAATGGTTCAGGATAATCCATCTGTCATAA
TTTCACCTTCGTCACGGACGGATGATAAAGATATCGGTGCGTATATTCGTTTTCGTCTGACCATCAGGGA
TGTTGCTACCGGACAAACCCGCCAGGAGTTCTGGAATGTTCGCCTGACTTATCGTATCGAACCGCAGGTT
GAAATGGTGTCAGGGGAACGTAATAACAATCCTCTTAAGTTCGTTGTAACAAGCTACGTTCGCGATAAAG
AAGCCAGAGGTTAA
 Primer design